KEGG   Equus caballus (horse): 791246
Entry
791246            CDS       T01058                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00220  Arginine biosynthesis
ecb00330  Arginine and proline metabolism
ecb01100  Metabolic pathways
ecb04020  Calcium signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04146  Peroxisome
ecb04371  Apelin signaling pathway
ecb04926  Relaxin signaling pathway
ecb05010  Alzheimer disease
ecb05014  Amyotrophic lateral sclerosis
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05133  Pertussis
ecb05140  Leishmaniasis
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05152  Tuberculosis
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    791246 (NOS2)
   00330 Arginine and proline metabolism
    791246 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    791246 (NOS2)
   04066 HIF-1 signaling pathway
    791246 (NOS2)
   04020 Calcium signaling pathway
    791246 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    791246 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    791246 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    791246 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    791246 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    791246 (NOS2)
   05014 Amyotrophic lateral sclerosis
    791246 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    791246 (NOS2)
   05152 Tuberculosis
    791246 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    791246 (NOS2)
   05145 Toxoplasmosis
    791246 (NOS2)
   05140 Leishmaniasis
    791246 (NOS2)
   05142 Chagas disease
    791246 (NOS2)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     791246 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 791246
NCBI-ProteinID: NP_001075238
Ensembl: ENSECAG00000024761
VGNC: 20814
UniProt: Q9BDH6
LinkDB
Position
11
AA seq 1311 aa
MACPWKFLFKAKFNQYDLTEEMDLNNNVWKSIQAPSSSVTQDDPKGHSLGKHRNESLQPV
TGMAKKSPESLVKLDVPPSACPRHVRIKNWGNGMTFEDMLHREANGEVACKSKSCLAAVM
NPKSMTRGPRDKPTPPDELLPHAIQFVNQYYNSFKEAKIEEHLARLEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYSTNNGNI
RSAITVFPQRSDGKHDFRIWNAQLIRYAGYQMPDGTIRGDPASVELTQLCIDLGWKPKYG
RFDVMPLVLQADGRDPELFEIPPDLVLEVPMEHPKYEWFQELGLKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDYCDAQRYNILEEVGRRMGLETHKLASLWKDRAVIEINV
AVLHSFQKQNVTIMDHHSAAESFMKHMQNEYRSRGGCPADWVWLVPRFSGSINPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKQSPRRRQIRFKVLVKAVLFASMLMRKTMASRVRAT
ILFATETGKSETLARDLGTLFSCAFNPKVLCMDEYQLSYLEEEQLLLVVTSTFGNGDFPG
NGEKLKKSLFMLKKLTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLTPTGEGD
ELGGQEDAFRNWAVQTFKTACETFNVRGKHQIQIPNFYTSNETWDPIHYRLVQNSEPLDL
SKTLSSMHAKNVFTMRLKSRQNLQSPKSSGTTLLIELSSEASQGLSYLPGEHLGVFPGNQ
PALVQGILERVVDGPAPDQPMRLETLDESGSYWVKDKRLPPCSLSQALTYFLDITTPPTQ
QLLRKLAQLATKEAERQRLETLCQPLEYNKWKFTNSPTFLKVLEEFPSLRVSAGFLLSQL
PILKPRYYSISSSRDRTPREVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSASGFRLPENPSHPCILVGPGTGIAPFRSFWLQRLHDAENRGLQGGRMTLVFGCRHPD
EDHLYQEEMLEMARKGVLHEVHTAYSRLPGQPKVYVQDILRQQLASEVLRVLHEEQGHIY
VCGDVRMARDVAHTLKQLVAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAVVPYKLRKDG
AAGQPSHPRAQSAPGKSYSCWHRTSVTEPTWITACREGGKLEPASHLISPSLSPKPFTWP
ATKYQPGLSGTSFLPLVHSSWIVESWGLPGPLETICNAGHVERVRMELASDCTSWSDHQE
ALSYHSVLVAPCTVIYESVFKKNKSQSAPTGTWVFLVCLLDGDIYMKCILF
NT seq 3936 nt   +upstreamnt  +downstreamnt
atggcctgtccttggaaatttctgttcaaggccaaattcaaccagtatgacttgactgaa
gaaatggacctcaacaacaacgtgtggaagagcatccaggcgccctccagttcagtgaca
caggatgaccccaagggtcacagcctcggcaagcacaggaatgagtccctgcagcccgtc
accggaatggcaaagaagtctccagaatccctggtcaagctggatgtgcccccctcggcc
tgcccacggcatgtgaggatcaaaaactggggtaacgggatgactttcgaggacatgctt
caccgcgaggccaatggggaggtcgcttgcaagtccaagtcttgcctggcagccgtcatg
aaccccaaaagtatgaccagagggcccagggacaagcctacccccccagatgagcttcta
cctcacgctatccaatttgtcaaccagtattacaactccttcaaagaagcaaaaatagag
gaacatctggccaggctggaagccgtaacaaaggagatagaaacaacaggaacctaccag
ctgacgggagatgagctcatctttgccaccaagcaggcctggcgcaatgccccccgctgc
atcgggaggatccagtggtccaacctacaggtctttgacgcccggagctgttctactgcc
caggaaatgttcgaacacatctgcagacacctgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagcgatggaaagcatgacttccggatctgg
aatgctcagctcatccggtatgccgggtaccagatgcctgatggcaccatcagaggggac
cctgcctctgtggagttaacccagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgatgtgatgcctctggtcctgcaggctgatggccgcgaccctgagctctttgaa
atccctcctgaccttgtgctcgaggtgcccatggaacatcccaagtacgagtggttccag
gagctggggctgaagtggtacgcactgccagcagtggccaacatgctgcttgaggtgggc
ggcctggagttcccagggtgccccttcaacggctggtacatgggcacggagattggggtc
cgagactactgtgatgcccagcgctacaacatcttggaggaagtggggagaaggatgggc
ctggaaacacacaagctggcctcgctctggaaggaccgggctgtcatcgagatcaatgtg
gctgtgctccacagtttccagaagcaaaatgtgaccatcatggaccaccactcagctgca
gagtccttcatgaagcacatgcagaatgagtaccggtcccgtgggggctgcccggccgac
tgggtttggctggtcccccgattttctgggagcattaaccccgtgttccaccaggagatg
ttaaactatgtcctgtcccctttctactactaccaggtggaggcctggaaaacccacgtc
tggcaggatgagaagcagagcccccggagaagacagattcgattcaaggtcttggttaaa
gccgtgctctttgcctccatgctgatgcgcaagaccatggcgtcccgagtcagagccaca
atcctctttgccacggagacgggaaaatcggaaacgctggcccgggacctggggactttg
ttcagttgtgctttcaaccccaaggttctctgcatggacgagtaccagctgagctacctg
gaagaggagcagcttctgctggtggtgaccagcacgtttggcaacggagacttccccggc
aacggagagaaattgaagaaatccctcttcatgctgaaaaagctcacgaacaagttcagg
tatgctgtgtttggccttggctccagcatgtaccctcagttctgtgccttcgctcatgac
attgaccagaagttgtctcacctgggggcctcgcagctcacccccacaggggaaggggat
gagctcggtggccaggaggatgccttccgcaactgggcggtgcaaaccttcaagacagcc
tgtgagacgttcaatgtccgaggcaaacaccaaattcagatccccaacttttacacctcc
aatgagacctgggacccgatccactacaggctcgtgcaaaactccgagcctttggacctt
agcaaaaccctcagcagtatgcacgccaagaatgtgttcaccatgaggctgaaatcgcgg
cagaatctacaaagtccgaagtccagcggcaccaccctcctgatagaactctccagtgag
gccagccaaggtctgagctacctgccaggggagcatcttggggttttcccaggcaaccag
ccggccctggtccaaggtatcttggagcgagtggtggatggccctgcacccgaccaaccc
atgcgcctggagaccctcgacgagagcggcagctactgggtcaaggacaagcggctgccc
ccctgctcactcagccaggcactcacctatttcctggacatcaccacacccccaacccaa
cagcttctccgaaagctggcccagctggccaccaaagaggctgagaggcagagactggag
accctgtgccagcccttggagtacaacaagtggaagttcaccaacagccccacattcctg
aaggtgctggaggagttcccgtccctgcgggtgtctgctggcttcctgctctcccagctt
cctattctgaaaccccggtactactccatcagctcctccagggaccgcacacccagggag
gtccacctcaccgtggctgtgctcacgtaccgcacccgagatggtcagggtcccctgcac
cacggcgtctgcagcacatggctcagcagcctgaagccccaagacccagtgccctgcttt
gtgcgaagtgccagtggcttccggctccctgagaacccctcccatccttgcatcctcgtc
gggcctggcacgggcattgcccccttccgcagtttctggctgcagcggctccatgatgcc
gagaacagagggctccaaggtggccgcatgaccctggtgttcgggtgccgccacccagat
gaggaccacctctatcaggaggagatgctggagatggcccggaaaggggtgctgcatgag
gtgcacacggcctattctcgcctccctggacagcccaaggtctatgttcaagacatcctg
cggcagcaactggccagtgaggtgctccgtgtgctccatgaggagcaaggccacatctat
gtctgtggggacgtgcgcatggcccgggacgtggcccacaccctgaagcagctggtggct
gccaagttgagcctgagtgaggagcaggtcgaggactatttcttccagcttaagagccag
aagcgctaccacgaagacatctttggtgctgtagttccctacaagctgagaaaggatggg
gccgcagggcagcccagccatcccagagcacaatcagcccccgggaaaagttacagctgc
tggcacagaacttcagtgacggagccaacttggattacagcctgcagagagggagggaaa
ttagaaccagcctcacatctcatttccccatctctttccccaaaaccctttacttggcct
gctaccaagtaccagcctggactgagtggaacctcctttctccctctggtccactcatcc
tggatagtggagagttggggccttcctggtcccttggagacaatctgcaatgccgggcac
gtcgagcgggtgaggatggaactggcttctgattgcacgtcttggagtgaccaccaggag
gcgctgtcgtaccactctgtattagttgccccatgtacagttatttatgagtctgtattt
aagaaaaacaaatcccagtctgctcctacaggcacttgggtcttccttgtatgtctcctt
gatggagatatttatatgaaatgcattttgttttaa

DBGET integrated database retrieval system