KEGG   Equus caballus (horse): 791253Help
Entry
791253            CDS       T01058                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2 precursor
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00590  Arachidonic acid metabolism
ecb01100  Metabolic pathways
ecb04064  NF-kappa B signaling pathway
ecb04370  VEGF signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04657  IL-17 signaling pathway
ecb04668  TNF signaling pathway
ecb04723  Retrograde endocannabinoid signaling
ecb04726  Serotonergic synapse
ecb04913  Ovarian steroidogenesis
ecb04921  Oxytocin signaling pathway
ecb04923  Regulation of lipolysis in adipocytes
ecb05140  Leishmaniasis
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05200  Pathways in cancer
ecb05204  Chemical carcinogenesis
ecb05206  MicroRNAs in cancer
ecb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    791253 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    791253 (PTGS2)
   04064 NF-kappa B signaling pathway
    791253 (PTGS2)
   04668 TNF signaling pathway
    791253 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    791253 (PTGS2)
   04657 IL-17 signaling pathway
    791253 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    791253 (PTGS2)
   04913 Ovarian Steroidogenesis
    791253 (PTGS2)
   04921 Oxytocin signaling pathway
    791253 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    791253 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    791253 (PTGS2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    791253 (PTGS2)
   05206 MicroRNAs in cancer
    791253 (PTGS2)
   05204 Chemical carcinogenesis
    791253 (PTGS2)
   05222 Small cell lung cancer
    791253 (PTGS2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    791253 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    791253 (PTGS2)
   05165 Human papillomavirus infection
    791253 (PTGS2)
   05140 Leishmaniasis
    791253 (PTGS2)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     791253 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 791253
NCBI-ProteinID: NP_001075244
Ensembl: ENSECAG00000017181
VGNC: 21997
UniProt: O19183
LinkDB All DBs
Position
5
AA seq 604 aa AA seqDB search
MLARALLLCVALALGHAANPCCSNPCQNRGVCMSVGFDQYQCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNSFPFLRNAVMKYVLVSRSHLIESPPTYNAQY
GYKSWESFSNLSYYTRALPPVADGCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDPKRGPAFTKGLGHGVDLSHIYGETLDRQHKLRLFKDGKMKY
QIINGEVYPPTVKDTQVEMIYPPHIPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIDDQEYNFQQFLYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAAQKIAKASIDQSREMKYQSLNEYRKRFRLTPYKSFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLLGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDPQLSKAVTINASASHSGLDDVNPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctctgcgtcgccctggcgctcggccacgcagcaaatcct
tgctgttccaacccgtgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccagtat
cagtgtgactgcacgcgcacaggattctatggtgaaaactgttcaacacctgaatttctg
acaaggataaaattattcctgaaacctactccaaacacagtacactacatacttacccac
ttcaagggagtctggaacattgtcaatagctttcccttcctgcgaaatgcagttatgaaa
tacgtgttagtatccagatcacatttgattgagagcccgccaacttacaatgcacagtat
ggctataagagctgggaatccttttccaacctctcgtattacaccagagctcttcctcct
gtggctgacggctgcccaacccccatgggtgtgaaagggaagaaagagcttcctgattca
aaagagattgtggaaaaatttctcctaagaagaaagttcatccctgacccccagggcaca
aatatgatgtttgcattttttgcccagcacttcacccatcagtttttcaagacagatcct
aagcgaggtccagctttcaccaaaggcctgggtcacggggtggatttaagtcatatttat
ggtgaaactttggatagacagcataaactgcgccttttcaaggacggaaaaatgaaatat
cagatcattaatggcgaggtgtatccgcccacagtcaaagacactcaggtggaaatgatc
tacccgcctcatattcctgagcacctgcggtttgctgtggggcaggaggtctttggtctg
gtgcctggcctgatgatgtatgccacgatttggctgcgggaacacaacagagtgtgtgat
gtcctcaaacaggagcatccagaatgggatgatgaacgcttgttccagacgagcaggctc
atactgataggagaaactatcaagatcgtgattgaagactacgtacagcacctgagcggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacagttccaataccaa
aaccgcattgccgctgagttcaacacgctctatcactggcatccccttctgcctgacacc
tttcaaatcgatgaccaggagtacaactttcaacagtttctctacaacaactctatctta
ctggaacatggactcacccagtttgttgaatctttcagcaggcaaattgctggcagggtg
gctggtggtaggaatgttccagctgcagcacagaaaatagcaaaggcctcaatcgaccag
agcagagagatgaagtaccagtctctgaatgagtaccgcaaacgctttcggctgacgccc
tataaatcatttgaagaacttacaggagagaaggaaatggctgcggagttagaagcactc
tatggtgacattgatgccatggagctgtatcctgcccttctggtggaaaagcctcgccca
gatgccatcttcggggagaccatggtagaacttggggcaccattctccttgaaaggactt
ttgggtaatcctatctgttctcctgactactggaaacccagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccttttactgccttcagtgttcaggacccgcagctcagcaaagcagtcaccattaat
gccagcgcttcccactctggactagatgacgtgaatcccacagtactgctcaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system