KEGG   Equus caballus (horse): 807855Help
Entry
807855            CDS       T01058                                 

Gene name
ND3
Definition
(RefSeq) NADH dehydrogenase subunit 3
  KO
K03880  NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00190  Oxidative phosphorylation
ecb01100  Metabolic pathways
ecb04714  Thermogenesis
ecb04723  Retrograde endocannabinoid signaling
ecb05012  Parkinson disease
Module
ecb_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    807855 (ND3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    807855 (ND3)
  09159 Environmental adaptation
   04714 Thermogenesis
    807855 (ND3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    807855 (ND3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ecb03029]
    807855 (ND3)
Enzymes [BR:ecb01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     807855 (ND3)
Mitochondrial biogenesis [BR:ecb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    807855 (ND3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxidored_q4
Motif
Other DBs
NCBI-GeneID: 807855
NCBI-ProteinID: NP_007167
UniProt: P48654 A5JYA8
LinkDB All DBs
Position
MT
AA seq 115 aa AA seqDB search
MNLMLTLLTNTLLASLLVLIAFWLPQLNIYAEKTSPYECGFDPMGSARLPFSMKFFLVAI
TFLLFDLEIALLLPLPWASQTTNLNTMLIMALVLISLLAISLAYEWTQKGLEWTE
NT seq 346 nt NT seq  +upstreamnt  +downstreamnt
ataaacctcatactgacactcctcactaacacattactagcctcgctactcgtactcatc
gcattctgactaccacaactaaacatctatgcagaaaaaaccagcccatatgaatgcgga
tttgaccctatagggtcagcacgcctccccttctcaataaaatttttcttagtggccatt
acatttctgctattcgacttagaaattgccctcctattaccccttccatgagcatcccaa
acaactaacctaaacactatacttatcatagcactagtcctaatctctcttctagccatc
agcctagcctacgaatgaacccaaaaaggactagaatgaactgagt

DBGET integrated database retrieval system