KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c0199Help
Entry
c0199             CDS       T00106                                 

Gene name
yaeG
Definition
(GenBank) Carbohydrate diacid regulator
  KO
K02647  carbohydrate diacid regulator
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecc03000]
    c0199 (yaeG)
Transcription factors [BR:ecc03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    c0199 (yaeG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Diacid_rec HTH_30 GGDEF_2 GAF_2
Motif
Other DBs
NCBI-ProteinID: AAN78693
UniProt: A0A0H2V486
LinkDB All DBs
Position
193495..194670
Genome map
AA seq 391 aa AA seqDB search
MHNGGLMAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIGELHEGALLV
LSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPENLRKYGELVCMTAEM
MLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALTEWAQRLGIDLNQPRVVAIVEVDSG
QLGVDSAMAELQQLQNALTTPERNNLVAIVSLTEMVVLKPALNSFGRWDAEDHRKRVEQL
ITRMKEYGQLRFRVSLGNYFTGPGSIARSYRTAKTTMMVGKQRMPESRCYFYQDLMLPVL
LDSLRGDWQANELARPLARLKAMDNNGLLRRTLAAWFRHNVQPLATSKALFIHRNTLEYR
LNRISELTGLDLGNFDDRLLLYVALQLDEER
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgcataatggaggacttatggctggctggcatcttgataccaaaatggcgcaggatatc
gtggcacgtaccatgcgcatcatcgataccaatatcaacgtaatggatgcccgcgggcga
attatcggcagcggcgatcgtgagcgtattggtgaattgcacgaaggagcattgctggta
ctttcacaaggacgagtcgtcgatatcgatgacgcggtggcacgtcatctgcacggtgtg
cggcaggggattaatctaccgttacggctggaaggtgaaattgtcggcgtaattggcctg
acaggtgaaccagagaatctgcgtaaatatggcgaactggtctgcatgacggctgaaatg
atgctggaacagtcgcggttgatgcacctgttggcgcaggatagccgtttgcgggaagaa
ctggtgatgaacctcattcaggctgaggagaatactcccgcacttactgaatgggcgcaa
cggctggggatcgatctcaatcaaccgcgagtggtggctattgttgaggtcgacagcggt
cagcttggtgtggacagcgcaatggcggagttacagcaactgcaaaatgcgctgactacg
cccgagcgtaataatctggtggcgattgtctcgctaaccgaaatggtggtgttgaaaccg
gcgttgaactcttttgggcgctgggacgcagaagatcatcgtaagcgagttgaacaactg
attacccgcatgaaagagtatggccagctgcgttttcgcgtttcgctgggcaactatttt
accggtcctggcagtattgcccgatcctatcgtacggcgaaaacgacgatgatggtgggt
aaacagcggatgccagaaagtcgctgctatttttatcaggatctgatgttacctgtgtta
ctcgacagtttgcgtggcgactggcaggccaacgaactggcgcgaccgctggcacggctg
aaagcgatggacaataacggcttgctgcggcgaacgctggcggcgtggtttcgccacaat
gtgcaaccgctggcaacgtcaaaggcgttgtttattcatcgtaatactctggaatatcgg
cttaatcgtatatcggaactgaccgggcttgatttgggcaattttgatgacaggttgctg
ctgtatgtggcgttacaactggatgaagagcggtag

DBGET integrated database retrieval system