KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c0480Help
Entry
c0480             CDS       T00106                                 

Gene name
yaiH
Definition
(GenBank) Penicillin-binding protein ampH
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ecc01002]
    c0480 (yaiH)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecc01011]
    c0480 (yaiH)
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     c0480 (yaiH)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     c0480 (yaiH)
Peptidases [BR:ecc01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   c0480 (yaiH)
Peptidoglycan biosynthesis and degradation proteins [BR:ecc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   c0480 (yaiH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AAN78958
UniProt: A0A0H2V4S6
LinkDB All DBs
Position
complement(469175..470332)
Genome map
AA seq 385 aa AA seqDB search
MKRSLLFSAVLYAASLTSVHAAQPITEPEFASDIVDRYADHIFYGSGATGMALVVIDGNQ
RVFRSYGETRPGNNVRPQLDSVIRIASLTKLMTSEMLVKLLDQGTVKLNDPLSKYAPPGA
RVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWKYLSTAKLKAAPGSQ
AAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTYTPSPDQCRRLMVAERGAS
PCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQADRMQTLIYQRAQFTKVIGMD
VPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAMIPQKNIGAFVVVTRSPLTRF
KNMSDGINDLVTELSGNKPLVIPAS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgtagtctgcttttttctgccgtgctgtatgcggcgtcattgacctccgtccat
gcggcgcagccgatcactgaaccggagtttgcctctgatattgtcgatcgttatgccgat
catattttttacggcagcggtgccacggggatggcgctggttgttatcgacggtaaccag
cgcgtctttcgcagttatggcgaaacgcgacctggtaataacgttcgcccgcagctggat
tccgtcatacgtattgcttccctcaccaagttaatgaccagtgagatgctggtgaaattg
ctcgaccaggggaccgtgaagttaaacgatccgctaagtaaatatgctccgccaggcgca
cgcgtaccgacctacaatgggacgcccattacgctggtgaatctggcaacccataccagc
gccctgccccgtgaacagcccggtggcgcggcacatcgtccggtatttgtctggccaacg
cgcgagcaacgctggaaatacctttccactgccaaactaaaagccgcgccgggcagccag
gccgcgtactccaacctcgcattcgatctgctggcagatgcactggcgaatgcgtccggc
aagccttatacccagttgtttgaagagcagattacccgtccgttggggatgaaagacacc
acctacaccccctcaccggatcagtgccgccgtttaatggttgctgagcgcggtgccagt
ccgtgcaataacacgctggcggcaattggcagcggcggcgtctattccacgccaggcgat
atgatgcgctggatgcagcagtatttgtcatctgatttttatcagcgcagtaaccaggct
gatcgcatgcagacgttgatttatcagcgcgcgcagtttacaaaagtgattggcatggat
gtccccggcaaagcggatgcgcttggtttaggctgggtatatatggccccgaaagagggt
cgtccggggattattcagaagacaggtggtggtggcggtttcattacctatatggcgatg
atcccgcagaagaatattggcgcgtttgtggtggtcactcgttcgccgttgacgcgcttt
aaaaatatgagcgatggcatcaatgacctggtgaccgagctaagcgggaataaaccgttg
gttatccccgcatcctga

DBGET integrated database retrieval system