KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c0831Help
Entry
c0831             CDS       T00106                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00010  Glycolysis / Gluconeogenesis
ecc00260  Glycine, serine and threonine metabolism
ecc00680  Methane metabolism
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01120  Microbial metabolism in diverse environments
ecc01130  Biosynthesis of antibiotics
ecc01200  Carbon metabolism
ecc01230  Biosynthesis of amino acids
Module
ecc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecc_M00002  Glycolysis, core module involving three-carbon compounds
ecc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    c0831 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    c0831 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    c0831 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecc04131]
    c0831 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecc04147]
    c0831 (gpmA)
Enzymes [BR:ecc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     c0831 (gpmA)
Membrane trafficking [BR:ecc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    c0831 (gpmA)
Exosome [BR:ecc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   c0831 (gpmA)
  Exosomal proteins of melanoma cells
   c0831 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AAN79304
UniProt: P62708
LinkDB All DBs
Structure
PDB: 

Position
complement(808419..809186)
Genome map
AA seq 255 aa AA seqDB search
MRSKYMAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFA
YTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQW
RRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKS
GERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADE
IAAKAAAVANQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgaggagtaagtatatggctgtaactaagctggttctggttcgtcatggcgaaagtcag
tggaacaaagaaaaccgtttcaccggttggtacgacgtggatctgtctgagaaaggcgta
agcgaagcaaaagcagcaggtaagctgctgaaagaggaaggttacagctttgactttgct
tacacctctgtgctgaaacgcgctattcataccctgtggaatgtgttggacgaactggat
caggcatggctgcccgttgagaaatcctggaaactgaacgaacgtcactacggtgcgttg
cagggtctgaacaaagcggaaaccgctgaaaagtatggcgacgagcaggtgaaacagtgg
cgtcgtggttttgcggtgactccgccggaactgactaaagatgatgagcgttatccgggg
cacgatccgcgttacgcgaaactgagcgagaaagagctgccgctgacggaaagcctggcg
ctgaccattgaccgcgtgatcccttactggaatgaaaccattctgccacgtatgaagagc
ggtgagcgcgtcatcatcgccgcacacggtaactcgttacgtgcgctggtgaaatatctc
gataacatgagcgaagaagagattcttgagctgaatatcccgaccggcgtgccgctggtt
tatgagtttgacgagaacttcaaaccgctgaaacgctattatctgggtaatgctgacgag
atcgcggcgaaagcagcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system