KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1695Help
Entry
c1695             CDS       T00106                                 

Definition
(GenBank) Hypothetical protein
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00591  Linoleic acid metabolism
ecc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    c1695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecc01004]
    c1695
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     c1695
Lipid biosynthesis proteins [BR:ecc01004]
 Desaturase
  Front-end
   c1695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DUF5357
Motif
Other DBs
NCBI-ProteinID: AAN80162
UniProt: A0A0H2V847
LinkDB All DBs
Position
1531105..1532196
Genome map
AA seq 363 aa AA seqDB search
MNLFNPDRLITFPADDPQLVKQLQSGTKVYLAKSGDHRYADGWAFAKMAALIIACLCCYA
LALSQSLWGLYLLWYLAMMFCAMLLAVNVVHDASHDAFLRGKKTNARLNRWVAFPMGLDP
DCWRVRHVRFHHGFTNIEFYDPDTAENGILRQTPWQRWRPFMRQQHHYWPLVAALTFPWY
IWVVDWLDRAGFTPVTRHLALRGFAGWGYFLAGKLAHCALCLILPWLLSDFSFMTILLTY
LLSQLLASLIFVTLIIGTHWAKGHTQLPPEEGKMPVGRLAHTFVTTFDWTPQPAWLGYWL
GGINLHLTHHLFPHWHHRHYPALSRIIAQIASQQGLDYQLLTLADLLRLQQQFLRRMGEK
PKA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgtttaatcccgacaggttaatcacttttcctgccgatgatccacaactggtg
aaacaactgcaaagcggtacgaaagtttatctggcgaaatcaggcgatcatcggtatgcc
gacggctgggcattcgccaaaatggcggcgttgattattgcctgtttatgctgctatgca
ctggcgttgtctcaaagcctgtgggggctgtatctgttgtggtatctcgcgatgatgttt
tgcgccatgttgttagcggtcaatgtggtgcatgacgcttcgcatgatgcgtttttgcgt
ggtaaaaagaccaatgcccgacttaaccggtgggttgcttttcctatggggctagatccg
gactgctggcgggtgcgccacgttcgctttcatcacggttttaccaatattgaattttac
gatccagacacagcagaaaatggcattcttcgccagacgccgtggcaacggtggcgacct
tttatgcgccagcaacatcactattggccactggtcgccgcgctcacctttccctggtat
atctgggtagtggactggctcgatcgcgcagggtttacgccggtcacgcgacatctggcc
ctgcgaggctttgctggctggggatatttcttagccgggaaactggcgcattgtgcgctg
tgtctgatacttccctggcttttgtctgattttagttttatgaccatcctgctgacttat
ctgctcagccagctgctggcgtcattgatttttgtgacgttgattattggaacgcactgg
gcgaagggacatacgcagttaccaccagaagagggcaaaatgcccgtgggcagactggcg
catacctttgttaccacctttgactggacgccgcaacctgcatggcttggctactggctg
ggcgggattaatctgcaccttacccatcatctgtttcctcactggcatcatcgccattat
ccggcgctaagccgcattattgcacaaattgccagccagcaaggtctggattatcagttg
ttgacgttagcggatttgttgaggctacagcagcagtttttacggcgaatgggggagaag
ccgaaggcttga

DBGET integrated database retrieval system