KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1729Help
Entry
c1729             CDS       T00106                                 

Gene name
trpD
Definition
(GenBank) Anthranilate synthase component II
  KO
K13497  anthranilate synthase/phosphoribosyltransferase [EC:4.1.3.27 2.4.2.18]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01130  Biosynthesis of antibiotics
ecc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    c1729 (trpD)
Enzymes [BR:ecc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     c1729 (trpD)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     c1729 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 GATase Glycos_trans_3N Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AAN80194
UniProt: A0A0H2V787
LinkDB All DBs
Position
complement(1563393..1564988)
Genome map
AA seq 531 aa AA seqDB search
MADILLLDNIDSFTYNLADQLRSNGHNVVIYRNHIPAQTLIERLATMSNPVLMLSPGPGV
PSEAGCMPELLTRLRGKLPIIGICLGHQAIVEAYGGYVGQAGEILHGKASSIEHDGQAMF
AGLTNPLPVARYHSLVGSNIPAGLTINAHFNGMVMAVRHDADRVCGFQFHPESILTTQGA
RLLEQTLAWAQQKLEPTNTLQPILEKLYQAQTLSQQESHQLFSAVVRGELKPEQLAAALV
SMKIRGEHPNEIAGAATALLENAAPFPRPDYLFADIVGTGGDGSNSINISTASAFVAAAC
GLKVAKHGNRSVSSKSGSSDLLAAFGINLDMNADKSRQALDELGVCFLFAPKYHTGFRHA
MPVRQQLKTRTLFNVLGPLINPAHPPLALIGVYSPELVLPIAETLRVLGYQRAAVVHSGG
MDEVSLHAPTIVAELHDGEIKSYQLTAEDFGLTPYHQEQLAGGTPEENRDILTRLLQGKG
DAAHEAAVAANVAMLMRLHGHEDLQANAQTVLEVLRSGSAYDRVTALAARG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctgacattctgctgctcgataatatcgactcttttacgtacaacctggcagatcag
ttgcgcagcaatggtcataacgtggtgatttaccgcaaccatattccggcgcagacctta
attgaacgcctggcgacgatgagcaatccggtgctgatgctttctcctggccccggtgtg
ccgagcgaagccggttgtatgccggaactcctcacccgcttgcgtggcaagctgccaatt
attggcatttgcctcggacatcaggcgattgtcgaagcttacgggggctatgtcggtcag
gcgggcgaaattcttcacggtaaagcgtcgagcattgaacatgacggtcaggcgatgttt
gccggattaacaaacccgctgccagtggcgcgttatcactcgctggttggcagtaacatt
ccggccggtttaaccatcaacgcccattttaatggcatggtgatggcggtgcgtcacgat
gcagatcgcgtttgtggattccagttccatccggaatccattcttactacccagggcgct
cgcctgctggaacaaacgctggcctgggcgcagcagaaactagagccaaccaacacgctg
caaccgattctggaaaaactgtatcaggcacagacgcttagccaacaagaaagccaccag
ctgttttcagcggtggtacgtggcgagctgaagccggaacaactggcggcggcgctggtg
agcatgaaaattcgcggtgaacacccgaacgagatcgccggggcagcaaccgcgctactg
gaaaacgccgcgccattcccgcgcccggattatctgtttgccgatatcgtcggtactggc
ggtgacggcagcaacagcatcaatatttctaccgccagtgcgtttgtcgccgcggcctgc
gggctgaaagtggcgaaacacggcaaccgtagcgtctccagtaaatccggctcgtcggat
ctgctggcggcgttcggtattaatcttgatatgaacgccgataaatcgcgccaggcgctg
gatgagttaggcgtctgtttcctctttgcgccgaagtatcacaccggattccgccatgcg
atgccggttcgccagcaactgaaaacccgcactctgttcaacgtgctgggaccattgatt
aacccggcgcatccgccgctggcgctaattggtgtttatagtccggaactggtgctgccg
attgccgaaaccttgcgcgtgctggggtatcaacgcgcggcagtggtgcacagcggcggg
atggatgaagtttcattacacgcgccgacaatcgttgccgaactacatgacggcgaaatt
aagagctatcaattgaccgctgaagattttggcctgacaccctaccaccaggagcaattg
gcaggcggaacaccggaagaaaaccgtgacattttaacacgcttgttacaaggtaaaggc
gacgccgcccatgaagcagccgtcgcggcgaatgtcgccatgttaatgcgcctgcatggc
catgaagatctgcaagccaatgcgcaaaccgttcttgaggtactgcgcagtggttccgct
tacgacagagtcaccgcactggcggcacgagggtaa

DBGET integrated database retrieval system