KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1759Help
Entry
c1759             CDS       T00106                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00061  Fatty acid biosynthesis
ecc00780  Biotin metabolism
ecc01100  Metabolic pathways
ecc01130  Biosynthesis of antibiotics
ecc01212  Fatty acid metabolism
Module
ecc_M00083  Fatty acid biosynthesis, elongation
ecc_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    c1759 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    c1759 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    c1759 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecc01004]
    c1759 (fabI)
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     c1759 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     c1759 (fabI)
Lipid biosynthesis proteins [BR:ecc01004]
 Fatty acid synthase
  Component type
   c1759 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AAN80225
UniProt: A0A0H2V6Z9
LinkDB All DBs
Structure
PDB: 

Position
complement(1594542..1595330)
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDTSIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctggtaaccggtgttgccagcaaactgtccatc
gcctacggtatcgctcaggcgatgcaccgcgaaggagctgaactggcattcacctaccag
aacgacaaactgaaaggccgcgtagaagaatttgccgctcaattgggttctgacatcgtt
ctgcagtgcgatgttgccgaagataccagcatcgacaccatgttcgctgaactggggaaa
gtttggccgaaatttgacggtttcgtacactctattggttttgcacctggcgatcagctg
gatggtgactatgttaacgccgttactcgtgaaggcttcaaaattgcccacgacatcagc
tcctacagcttcgttgcaatggcaaaagcttgccgctccatgctgaatccgggttctgcc
ctgctgaccctttcctaccttggcgctgagcgcgctatcccgaattacaacgttatgggt
ctggcaaaagcgtctctggaagcgaacgtgcgctatatggcgaacgcgatgggtccggaa
ggtgtgcgtgttaacgccatctctgctggtccgatccgtactctggcggcttccggtatc
aaagacttccgcaaaatgctggctcattgcgaagccgttaccccgattcgccgtaccgtt
actattgaagatgtgggtaactccgcggcattcctgtgctccgatctctctgccggtatc
tccggtgaagtggtccacgttgacggcggtttcagcatcgctgcaatgaacgaactcgaa
ctgaaataa

DBGET integrated database retrieval system