KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1922Help
Entry
c1922             CDS       T00106                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00250  Alanine, aspartate and glutamate metabolism
ecc00410  beta-Alanine metabolism
ecc00430  Taurine and hypotaurine metabolism
ecc00650  Butanoate metabolism
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01120  Microbial metabolism in diverse environments
ecc02024  Quorum sensing
Module
ecc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    c1922 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    c1922 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    c1922 (gadB)
   00430 Taurine and hypotaurine metabolism
    c1922 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    c1922 (gadB)
Enzymes [BR:ecc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     c1922 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 PRTase_3
Motif
Other DBs
NCBI-ProteinID: AAN80380
UniProt: Q8FHG5
LinkDB All DBs
Structure
PDB: 

Position
complement(1756318..1757787)
Genome map
AA seq 489 aa AA seqDB search
MHLLTLSINPTFLMRSNHFKEFKMDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEM
RDDVAFQIINDELYLDGNARQNLATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAID
LRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTNKPNL
VCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNY
EFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKF
GLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGRE
GYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSE
RLRLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGI
AQQNSFKHT
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgcacttgcttactttatcgataaatcctacttttttaatgcgatccaatcattttaag
gagtttaaaatggataagaagcaagtaacggatttaaggtcggaactactcgattcacgt
tttggtgcgaagtctatttccactatcgcagaatcaaaacgttttccgctgcacgaaatg
cgtgatgatgtcgcattccagattatcaatgatgaattatatcttgatggcaacgctcgt
cagaacctggccactttctgccagacctgggacgacgataatgtccataagttgatggat
ttatccattaacaaaaactggatcgacaaagaagaatatccgcaatctgcagcaatcgat
ctgcgttgcgtaaacatggttgccgatctgtggcatgcgcctgcaccgaaaaatggtcag
gccgttggcaccaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatg
aaatggcgttggcgcaagcgtatggaagctgcaggtaagccgactaacaaaccgaacctg
gtgtgcggtccggtacaaatctgctggcataaattcgcccgctactgggatgtggagttg
cgtgagatccctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcc
tgcgacgaaaacaccatcggcgtggtgccgactttcggcgtgacctacaccggtaactat
gagttcccgcagccgctgcacgatgcgctggataaattccaggccgacaccggtatcgac
atcgacatgcacatcgacgccgccagcggtggcttcctggcaccgttcgtcgccccggat
atcgtctgggacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattc
ggtctggctccgctgggctgcggctgggttatctggcgtgatgaagaagcgctgccgcag
gaactggtgttcaacgttgactacctcggcggtcagattggtactttcgccatcaacttc
tcccgcccggcgggtcaggtgattgcacagtactatgaattcctgcgcctcggtcgtgaa
ggctatacaaaagtacagaacgcttcctaccaggttgctgcttatctggcggatgaaatc
gccaaactggggccgtatgagttcatctgtacgggtcgcccggacgaaggcatcccggcg
gtttgcttcaaactgaaagatggtgaagatccgggatacaccctgtatgacctctctgaa
cgtctgcgtctgcgcggctggcaggttccggccttcactctcggcggtgaagccactgac
atcgtggtgatgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttg
ctggaagactacaaagcctccctgaaatatctcagcgaccacccgaaactgcagggtatt
gcccagcagaacagctttaaacacacctga

DBGET integrated database retrieval system