KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2050Help
Entry
c2050             CDS       T00106                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase (Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     c2050 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AAN80510
UniProt: P0AGD4
LinkDB All DBs
Structure
PDB: 

Position
1891532..1892113
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFG
SGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEHFWA
LVNWEFVAKNLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgaattacctgcactaccatatgctaaagatgctctggcaccgcacatttct
gcggaaaccatcgagtatcactacggcaagcatcatcagacttatgtcactaacctgaac
aacctgatcaaaggtaccgcgtttgaaggtaaatcactggaagagattattcgcagctct
gaaggtggcgtattcaacaacgcagctcaggtctggaaccatactttctactggaactgc
ctggcaccgaacgcgggtggcgaaccgactggaaaagtcgctgaagctatcgccgcatct
tttggcagctttgccgatttcaaagctcagtttactgatgcagcgatcaaaaactttggt
tctggctggacctggctggtgaaaaacagcgatggcaaactggctatcgtttcaacctct
aacgcgggtactccactgaccaccgatgcgactccgctgctgaccgttgatgtctgggaa
cacgcttattacatcgactatcgcaatgcacgtcctggctatctggagcacttctgggcg
ctggtgaactgggaattcgtagcgaaaaatctcgctgcataa

DBGET integrated database retrieval system