KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2178Help
Entry
c2178             CDS       T00106                                 

Gene name
ydjJ
Definition
(GenBank) Hypothetical zinc-type alcohol dehydrogenase-like protein ydjJ
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 ADH_N_2 Cupin_2 ThiF
Motif
Other DBs
NCBI-ProteinID: AAN80637
UniProt: A0A0H2V963
LinkDB All DBs
Structure
PDB: 

Position
complement(2015020..2016063)
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIIILGAGCI
GLMTLQACKCLGATEIAVVDVLEKRLTMAEQLGATVVINGAKEDTIARCQQFTEDMGADI
VFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYRDVQQAFEESVNNKRDIIKGVIKISD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcaatattgcaggtgccgggcacaatgaaaattatttcagcagaa
atacctgtgcctaaagaagatgaagttttgattaaagtggaatatgtcggtatttgtggt
tcagatgtacatggttttgaatcaggcccgtttattcctcctaaagacccaaatcaagaa
attggcctgggtcatgaatgcgccgggacggttgtggctgtgggaagccgcgtgcgcaaa
tttaaaccgggggatcgggtaaatatcgaacctggcgttccttgcggtcactgtcgttac
tgtctggaaggcaaatataacatttgcccggacgttgattttatggcgacacaacccaac
taccgcggcgcattaacgcactatctgtgtcatccggagagctttacttacaaactgcca
gacaatatggacacgatggaaggggcgctggtggagcctgccgcagtcgggatgcatgcc
gcgatgctggcagatgttaaacctggtaagaagataattattctgggagcgggttgtatt
ggtttgatgacgttgcaagcgtgcaaatgcctgggagcaacggaaattgccgtcgttgat
gtgctggaaaaacgtctgacaatggcggaacagctcggcgcgacagtggttattaacggc
gcaaaagaagacactattgcacgctgtcagcaatttaccgaagacatgggcgcagatatt
gtttttgaaacagcgggttctgcggtcaccgttaaacaggcaccttatctggtcatgcgc
ggcggtaaaattatgattgttggtactgtacccggcgattcggcaatcaatttcctcaaa
atcaatcgcgaagtcactatccagacggtattccgctatgccaatcgttatccggtcacg
attgaagctatttcctcagggcgattcgatgtgaaatcgatggtgacgcatatttacgat
tatcgggatgtacaacaggcatttgaagagtcagttaacaacaaacgcgacattattaaa
ggcgttattaaaattagcgattaa

DBGET integrated database retrieval system