KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c2696Help
Entry
c2696             CDS       T00106                                 

Gene name
yeiK
Definition
(GenBank) Hypothetical protein yeiK
  KO
K10213  ribosylpyrimidine nucleosidase [EC:3.2.2.8]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00230  Purine metabolism
ecc00240  Pyrimidine metabolism
ecc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    c2696 (yeiK)
   00240 Pyrimidine metabolism
    c2696 (yeiK)
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.8  ribosylpyrimidine nucleosidase
     c2696 (yeiK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-ProteinID: AAN81152
UniProt: Q8FFT8
LinkDB All DBs
Structure
PDB: 

Position
complement(2544750..2545691)
Genome map
AA seq 313 aa AA seqDB search
MEKRKIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVAGNQTLDKTLINGLNVCQKLEIN
VPVYAGMPQPIMRQQIVADNIHGETGLDGPVFEPLTRQAENTHAVKYIIDTLMASDGDIT
LVPVGPLSNIAVAMRMQPAILPKIREIVLMGGAYGTGNFTPSAEFNIFADPEAARVVFTS
GVPLVMMGLDLTNQTVCTPDVIARMERAGGPAGELFSDIMNFTLKTQFENYGLAGGPVHD
ATCIGYLINPDGIKTQEMYVEVDVNSGPCYGRTVCDELGVLGKPANTKVGITIDTDWFWG
LVEECVRGYIKTH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagagaaaaattattctggattgtgatccgggtcatgatgatgctattgctata
atgatggcggcgaaacatccggcgattgatttattaggtatcaccattgtagcgggtaat
caaaccctcgataaaacattaattaatggcctgaatgtttgccagaaactggagattaat
gttccggtttatgcggggatgccgcagcccattatgcgtcaacaaattgttgccgataat
attcacggtgaaaccggactggatggcccggtattcgagccgctgacccgccaggcagaa
aacactcatgcggtgaaatatatcatcgatacccttatggcaagcgatggcgatatcact
ctggtgccggttggtccgttgtcaaacatcgcggtggcaatgcgtatgcaacccgcgatc
ctgccgaaaatccgtgaaattgttctgatgggcggtgcttatggtactggcaacttcacc
ccatctgctgagttcaacatctttgctgacccggaggccgcacgcgtggtgttcacctcc
ggcgttccattagtgatgatgggcctcgatcttaccaaccagaccgtttgcaccccggac
gtgattgctcggatggaaagggctggcggccctgccggagagctgttcagcgacatcatg
aacttcactctcaaaacgcagttcgaaaactacggcctggctggcggcccggtgcacgac
gccacctgcatcggttatttgattaaccctgatggcattaaaacccaggagatgtacgtc
gaagtggacgttaacagtggcccttgctatgggcgtaccgtctgcgacgagctgggtgtt
cttggcaagcccgccaataccaaagtcggcatcactattgataccgactggttctgggga
ttagtcgaagagtgcgtacgcggctacataaaaacccattaa

DBGET integrated database retrieval system