KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c3210Help
Entry
c3210             CDS       T00106                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00250  Alanine, aspartate and glutamate metabolism
ecc00280  Valine, leucine and isoleucine degradation
ecc00410  beta-Alanine metabolism
ecc00640  Propanoate metabolism
ecc00650  Butanoate metabolism
ecc01100  Metabolic pathways
ecc01120  Microbial metabolism in diverse environments
Module
ecc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    c3210 (gabT)
   00650 Butanoate metabolism
    c3210 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    c3210 (gabT)
   00280 Valine, leucine and isoleucine degradation
    c3210 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    c3210 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecc01007]
    c3210 (gabT)
Enzymes [BR:ecc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     c3210 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     c3210 (gabT)
Amino acid related enzymes [BR:ecc01007]
 Aminotransferase (transaminase)
  Class III
   c3210 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AAN81662
UniProt: A0A0H2VA09
LinkDB All DBs
Structure
PDB: 

Position
3071401..3072687
Genome map
AA seq 428 aa AA seqDB search
MRMSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHL
HPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENA
VKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGI
SEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIA
DEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTY
AGNPIACVAALEVLKVFEQENLLQKANVLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIE
LFEDGEHSKPDVKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIIS
QCFAEAKQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggc
gttgggcaaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgtt
gaaggccgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctg
catccgaaagtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttc
caggtgctggcttacgagccgtatcttgaactgtgcgagattatgaatcagaaggtgccg
ggcgattttgccaagaaaactctgctggttacgaccggttccgaagcggtggaaaatgcg
gtgaaaatcgcccgcgccgccaccaaacgtagcgggaccatcgcctttagcggtgcgtat
cacgggcgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggc
atggggctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcata
agcgaggatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaa
gatatcgccgccatcgtgattgagcccgttcagggcgaaggcggtttctacgccgcgacg
ccagcctttatgcagcgtttacgcgcgctgtgtgacgagcatgggatcatgctgattgcc
gatgaagtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcaaatgggc
gtggcaccagatctcaccacctttgcgaaatcgatcgcaggcggtttcccgctggcgggc
gtcaccgggcgcgcggaagtgatggacgccgtcgcaccgggcggactgggtggcacctat
gccggtaacccgattgcctgcgtagcggcgctggaagtgttgaaggtgttcgagcaggaa
aatctgctgcaaaaagccaacgttctggggcagaagctgaaagacggattgctggcgatc
gccgaaaaacacccggagatcggcgacgtacgcgggctgggggcgatgatcgccatcgag
ctgtttgaagatggcgaacacagcaaaccggacgtaaaactcaccgccgagatcgtggca
cgcgcccgcgataagggtctgattcttctctcctgcggcccgtattacaacgtgctgcgc
atccttgtaccgctcaccattgaagacgctcagatccgtcagggtctggaaatcatcagc
cagtgttttgctgaggcgaagcagtag

DBGET integrated database retrieval system