KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c5032Help
Entry
c5032             CDS       T00106                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00020  Citrate cycle (TCA cycle)
ecc00310  Lysine degradation
ecc00380  Tryptophan metabolism
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01120  Microbial metabolism in diverse environments
ecc01130  Biosynthesis of antibiotics
ecc01200  Carbon metabolism
Module
ecc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    c5032
  09105 Amino acid metabolism
   00310 Lysine degradation
    c5032
   00380 Tryptophan metabolism
    c5032
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     c5032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N YihI PFOR_II
Motif
Other DBs
NCBI-ProteinID: AAN83458
UniProt: A0A0H2VFQ6
LinkDB All DBs
Position
4808228..4811047
Genome map
AA seq 939 aa AA seqDB search
MKISVFNCWYGLCSNAAVYDHQEKNMENMTSPGTLLSGDNATWLEEYYQTWLRTPEQLPE
DWRRFFLSPELTVQSVSGDNNVSGATLKKQAAVIQLINAWRTQGHLRAKLDPLGLNPPAD
VPSLQPGFWGLSEEDLLQEFSVTFGAHTTQMPLKQLLNLLEQAWAGSQAYELAHLENREE
INWLLSRIESSNAPQADVQTCIARFEKLMAAETLERYLHTRYVGQKRFSLEGGESAIPAL
DTLTKRLRAQGVEEMVIGMAHRGRLNVLVNLLNKDPAQLFAEFEGKQTIGSGSGDVKYHM
GYSSNLETPAGSLHVALAYNPSHLEIVNPVVLGQVRARQERRGEDGQAKVVGVLIHGDSA
LGGLGVNQTTFNLSQTQGYGTGGTLHLVINNQIGFTTSRLQDMRSSRYCTDIAKMVAAPI
IHVNGDDVDAVCQVMELACEWRDTFRRDIIIDICCFRKHGHNESDEPRLTQPQMYQAVDA
HPGTLARYGESLARRGLLTQAQQDEMTARYRDWLDSCQKREPQPLKPAIHSFSANWYGLT
NPHWSAPVSTALPRQKLAAYGEIISTLPPDVVAHPTIKRQLALRQDMAAGTQPIDWGMAE
MLAYASLVDAGVGVRLSGEDSGRGTFSHRHAVVHHQTEARRYLPLQHIRAGQASFDVYDS
VLNEEALLAFEYGYSTSAPQQLVIWEAQFGDFANGAQVAIDQFISSGETKWDRYSGLTIL
LPHGYDGQGPEHSSARPERWLQLCAENNMQVVMPSESAQMFHLLRGQALRPMRKPLVIMM
SKRLLRFKGAMSELCEFTDGAYKPVITDPQLHQSQKVKRVILCSGQVYYDVLEARKQREH
EDEVAIVRLEQLYPFPVAELNDVLASWPNCCEWIWLQEEPENQGAWRQIRHELAALKINT
PYWQYAGRPAAAAPATGYGRVHKQQIDEFLAAAFADIQP
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattagtgtttttaactgttggtacggattgtgcagtaatgcggctgtctatgac
catcaggagaaaaacatggagaacatgacctcgcccggcacgctgcttagtggagataac
gcgacctggcttgaagagtactaccagacctggttgcgtacgccggaacaactcccggaa
gactggcggcgtttttttctttcacctgaactgactgtccaaagcgtatccggtgataac
aacgtcagcggtgcgacgttaaaaaaacaggctgcggtaatacaactgatcaatgcctgg
cgcacgcaggggcatctgcgcgcaaagcttgatccacttggtttgaatcccccggctgac
gttccctccctccagcctggtttttggggattaagcgaagaagacttgttgcaggaattt
agcgtcacctttggcgcacacaccacgcaaatgccacttaagcaactgcttaacctgctg
gagcaagcctgggcgggtagccaggcttatgaacttgctcatctggaaaatcgtgaagaa
atcaactggttgttatcacggattgagagcagcaatgcgccacaagcagatgtacaaacc
tgtattgctcgttttgaaaaactgatggcggcagagacgttagagcgttatctgcatacc
cgttatgttgggcagaaacggttttctctggaagggggcgaaagtgcaatcccggcgctc
gatacgctgacaaaacgcctgcgtgcgcaaggtgtggaggaaatggtcattggcatggcg
caccggggaagacttaatgttctggttaatctgttgaataaagacccggcacagcttttt
gctgagtttgaaggcaagcagacgatcggcagtggttcaggcgatgtgaaataccacatg
gggtattccagcaatctggaaacacctgccggttcgctgcatgtggcgctggcgtataac
ccctcacatctggagatcgtgaatccggtggtgctgggccaggtgcgagccaggcaggaa
cgccgtggtgaggatggtcaggcaaaagtggtgggcgtacttattcatggggattccgcg
ttgggcggcctcggcgtcaaccaaaccacgtttaacttatcgcagactcagggctacggc
actggcggtacgctacatctggtgattaacaatcagattggcttcaccacttcccgcttg
caggatatgcgttcttcacggtactgcaccgatattgccaaaatggtagcggccccaatt
atccacgttaatggcgatgacgttgacgctgtttgccaggtaatggaactggcgtgcgaa
tggcgagacaccttccggcgcgacatcatcatcgatatttgctgcttccgtaagcacgga
cacaacgaaagcgatgagccacgtcttacccagccacaaatgtatcaggcagtggatgct
caccctggtacgctcgcccgttatggtgaatctcttgcccgccgcggcctgttaactcag
gcgcaacaagatgagatgacggcacgctatcgcgactggctggatagctgccagaaacgt
gaaccgcagcctctcaaacctgcaattcactcttttagcgctaactggtatgggttgacc
aaccctcactggagcgccccggtatctacggcattgcctcggcaaaagctggcagcgtat
ggtgaaatcatttctacgctgccacccgatgtggtcgcacatcctaccattaaacggcaa
ctggcgttacgccaggatatggccgcaggtactcagccaatagactggggaatggctgaa
atgctggcctatgcatcgcttgtggatgcgggtgttggtgtgcgtctttctggtgaagac
tcagggcgtggcacgttcagtcatcgccatgcagtggtacatcatcaaactgaagcccgt
cgttatctgccgttacagcatatccgcgctggtcaggcatctttcgatgtttatgattcg
gtgcttaatgaagaagcgctcttagcctttgaatatggctattcaacgtctgcgcctcag
caactggttatttgggaagcacagtttggtgactttgccaacggcgctcaggttgctatt
gaccagtttatctcgtctggcgaaaccaagtgggatcgctatagcggtttaaccattctt
ctgccgcatggctatgacggacaagggccggagcactcttctgcgcgtcctgagcgctgg
ctgcaactgtgcgcagaaaacaacatgcaggtggtgatgcccagtgagtcagcacaaatg
ttccatttgttgcgcggtcaggcattacgcccaatgcgcaaaccgttagtgataatgatg
agtaagcgtttacttcggtttaaaggcgctatgagcgagctttgtgaattcactgatggc
gcttataaaccggtaatcaccgatccgcaattgcatcagtcccagaaagttaagcgcgtt
attttgtgtagcggccaggtctattacgacgtactggaagcccgtaagcagcgtgagcat
gaagacgaagtggcgattgttcgcctggagcaactctacccgttcccggtcgcagaactg
aatgatgttctggcgagttggccgaactgctgcgaatggatttggttgcaggaagagcca
gaaaaccagggcgcgtggcggcagattcgtcatgagctggcggcactgaaaattaacact
ccttactggcagtatgcaggccgcccggcagcggcagctccggcgacagggtatgggcgt
gtacataaacaacaaatcgacgaatttcttgctgctgcgtttgcagatattcagccatga

DBGET integrated database retrieval system