KEGG   Escherichia coli K-12 DH10B: ECDH10B_0908Help
Entry
ECDH10B_0908      CDS       T00666                                 

Gene name
dacC
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 6a)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd00550  Peptidoglycan biosynthesis
ecd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECDH10B_0908 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecd01002]
    ECDH10B_0908 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecd01011]
    ECDH10B_0908 (dacC)
Enzymes [BR:ecd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECDH10B_0908 (dacC)
Peptidases and inhibitors [BR:ecd01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ECDH10B_0908 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:ecd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ECDH10B_0908 (dacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ACB02040
LinkDB All DBs
Structure
PDB: 

Position
933878..935080
Genome map
AA seq 400 aa AA seqDB search
MTQYSSLLRGLAAGSAFLFLFAPTAFAAEQTVEAPSVDARAWILMDYASGKVLAEGNADE
KLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWATGNPALRGSSVMFLKPGDQVS
VADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTFQTVHGLDAPGQ
FSTARDMALLGKALIHDVPEEYAIHKEKEFTFNKIRQPNRNRLLWSSNLNVDGMKTGTTA
GAGYNLVASATQGDMRLISVVLGAKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFVTQ
RVWFGDKSEVNLGAGEAGSVTIPRGQLKNLKASYTLTEPQLTAPLKKGQVVGTIDFQLNG
KSIEQRPLIVMENVEEGGFFGRVWDFVMMKFHQWFGSWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatactcctctctccttcgtggtcttgcagcgggttctgcatttttattcctt
tttgccccaacggcattcgcggcggaacaaaccgttgaagcgccgagcgtggatgcgcgt
gcatggattttaatggattacgccagcggtaaagtgctggcagaaggcaatgcggatgag
aaactggatcccgcgagcctgactaaaatcatgaccagctatgtggttgggcaggcgctt
aaggccgataagattaaactcaccgatatggtgacggtcggtaaagatgcctgggcgacg
ggaaatccggcactgcgtggttcatcggtaatgttcctcaaaccgggcgatcaggtttcg
gtggcagacttgaacaaaggtgtgattatccagtccggtaatgacgcctgtattgcgctg
gctgattacgttgccgggagccaggagtcatttattggtctgatgaatggttatgccaaa
aaactgggtctgaccaacactaccttccagacggtgcacggcctggatgcgccggggcag
ttcagcaccgcgcgcgatatggcattgctgggtaaagcattgatccacgatgtgccggaa
gagtacgccattcataaagagaaagagttcaccttcaacaaaattcgtcagcctaaccgt
aaccgtctgctgtggagcagcaatctgaatgttgatggcatgaagacaggaaccacggca
ggcgcgggatataatctggttgcttcggctacccagggcgatatgcgtttaatctccgta
gtgttgggggcgaaaaccgaccgtatccgttttaatgagtctgagaaattattgacctgg
ggtttccgcttctttgaaaccgtgacgccaattaaacctgatgccacctttgtgactcag
cgcgtctggtttggtgataagagcgaagtgaatctcggggcaggtgaagcgggctcagtg
accataccgcgtgggcagctgaaaaacctgaaagcgagttatacgttaacggaaccgcag
cttaccgcaccgctgaaaaaaggtcaggttgtcgggaccattgatttccagcttaacggt
aaatccattgagcagcgtccgctgatcgtgatggaaaatgtggaagagggcggattcttt
ggtcgggtgtgggatttcgtgatgatgaaattccatcagtggttcggcagctggttctct
taa

DBGET integrated database retrieval system