KEGG   Escherichia coli K-12 DH10B: ECDH10B_1606Help
Entry
ECDH10B_1606      CDS       T00666                                 

Gene name
fdnH
Definition
(GenBank) formate dehydrogenase-N, Fe-S (beta) subunit, nitrate-inducible
  KO
K08349  formate dehydrogenase-N, beta subunit
Organism
ecd  Escherichia coli K-12 DH10B
Pathway
ecd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECDH10B_1606 (fdnH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_6 Fer4_2 Fer4 Fer4_21 Fer4_4 Fer4_3 Fer4_17 Fer4_16 GP120 Fer4_8 Fer4_13 Fer4_18 Fer4_20 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ACB02688
LinkDB All DBs
Structure
PDB: 

Position
1639080..1639964
Genome map
AA seq 294 aa AA seqDB search
MAMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVG
HCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQ
YANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCP
TGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGL
PKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEEDHHE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggctatggaaacgcaggacattatcaaaaggtccgcaactaactccatcacgccgcct
tctcaggtgcgtgattacaaagcagaagtcgcaaaacttatcgacgtttccacctgtatc
ggctgtaaagcctgtcaggtggcgtgttcggagtggaacgacatccgtgatgaagtgggg
cactgcgtcggggtttacgataaccccgccgatctgagcgccaagtcctggacggtgatg
cgctttagcgaaaccgaacagaacggcaagctggagtggctgatccgtaaagacggctgt
atgcactgtgaagatcccggctgcctgaaggcgtgcccgtctgctggtgcaatcattcag
tacgctaacgggattgtcgatttccagtcggaaaactgcatcggctgtggttactgcatt
gccgggtgtccgtttaatattccgcgcctcaacaaagaggataaccgggtatataaatgc
acgctctgcgtcgatcgcgtcagcgtcggccaggaaccggcttgtgtgaaaacctgtccg
accggggctatccacttcggcaccaagaaggagatgctggagctggcggaacagcgcgtg
gcgaaactgaaagcgcgtggttacgaacatgctggcgtctacaacccggaaggggtcggt
ggtacgcacgttatgtacgtgctgcatcacgccgatcagccggagctgtatcacggtctg
ccgaaagatccgaagatcgacacctcggtaagcctgtggaaaggcgcgttgaaaccgctg
gcagcggctggctttattgccacttttgccgggttgattttccactacatcggtattggc
ccgaataaggaagtggacgatgacgaggaggatcatcatgagtaa

DBGET integrated database retrieval system