KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z0925Help
Entry
Z0925             CDS       T00044                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00010  Glycolysis / Gluconeogenesis
ece00260  Glycine, serine and threonine metabolism
ece00680  Methane metabolism
ece01100  Metabolic pathways
ece01110  Biosynthesis of secondary metabolites
ece01120  Microbial metabolism in diverse environments
ece01130  Biosynthesis of antibiotics
ece01200  Carbon metabolism
ece01230  Biosynthesis of amino acids
Module
ece_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ece_M00002  Glycolysis, core module involving three-carbon compounds
ece_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ece00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Z0925 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    Z0925 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Z0925 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ece04131]
    Z0925 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ece04147]
    Z0925 (gpmA)
Enzymes [BR:ece01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Z0925 (gpmA)
Membrane trafficking [BR:ece04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Z0925 (gpmA)
Exosome [BR:ece04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Z0925 (gpmA)
  Exosomal proteins of melanoma cells
   Z0925 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AAG55084
UniProt: P62709
LinkDB All DBs
Structure
PDB: 

Position
complement(872363..873115)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaaatatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtaatc
atcgctgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagctgaatatcccgaccggcgtgccgctggtttatgagtttgacgag
aacttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcagccgttgcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system