KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z0990
Entry
Z0990             CDS       T00044                                 

Definition
(GenBank) unknown protein encoded by prophage CP-933K
  KO
K23656  T3SS secreted effector NleD
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ece00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    Z0990
SSDB
Motif
Pfam: Peptidase_M91
Other DBs
NCBI-ProteinID: AAG55143
UniProt: Q8X829
LinkDB
Position
930245..930943
AA seq 232 aa
MRPTSLNLVLHQSSRSSSMSDTDIESLVKASSVQWIKNNPQLRFQGTDHNIYQQIEAALD
KIGSTETGRVLLNAIESISRLKSETVVIHLNSSRLGVMAHRDIDAENHRGTGSDFHCNLN
AVEYPCGEGISVVDFHATIVFHELLHVFHNLNGERLKVESSRAESQKYSPLLLEEARTVG
LGAFSEEVLSENKFHEEIGMPRRTSYPXDSALIHDDNTVSLGFQQVRLHPLL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgcgccctacgtccctcaacttggtattacatcagtcatcaaggtcgagctcaatgtca
gatacagatatcgagtctcttgtaaaagcatcgagcgttcaatggataaaaaataatccg
caacttcgtttccaggggactgatcataatatatatcagcagattgaagcagcactcgat
aagattggctctacagagacagggcgtgtactcctgaatgctattgaatcaatatcccga
cttaaatcagaaacagtggtaatacacctcaactcttccagactaggagttatggcacat
agagatatagatgctgagaaccatcgggggactggttccgattttcactgtaatctgaat
gcagttgaatatccctgtggggaggggattagcgtggtggactttcatgcgactattgtt
tttcatgagttgctccatgttttccacaatttaaatggggagcgtttgaaagttgagagt
tcccgagcagaatcacaaaaatactctccacttttactcgaagaagccaggactgttggg
ttgggggctttttcagaggaggtgctttcagaaaataaattccacgaagagattgggatg
ccccgtagaacctcctacccgcrcgactcagctcttattcatgatgacaatacagtgagt
ctgggattccaacaggtaagactgcatccattgctttag

DBGET integrated database retrieval system