KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z2015Help
Entry
Z2015             CDS       T00044                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00240  Pyrimidine metabolism
ece01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ece00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Z2015 (tdk)
Enzymes [BR:ece01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Z2015 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD AAA_30
Motif
Other DBs
NCBI-ProteinID: AAG56095
UniProt: P0A3L9
LinkDB All DBs
Position
1830507..1831124
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNSSLFDEIRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDF
RGELFIGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALQVXSLTAIQERHRHD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattccgcaatgaatgcgggtaagtctacagcattgttg
caatcttcatacaattaccaggaacgcggcatgcgcactgtcgtatatacggcagaaatt
gatgatcgctttggtgccgggaaagtcagttcgcgtataggtttgtcatcgcctgcaaaa
ttatttaaccaaaattcatcattatttgatgagattcgtgcggaacatgagcagcaggca
attcattgcgtactggttgatgaatgccagtttttaaccagacaacaagtatatgaatta
tcggaggttgtcgatcaactcgatatacccgtactttgttatggtttacgtaccgatttt
cgaggtgaattatttattggcagccaatacttactggcatggtccgacaaactggttgaa
ttaaaaaccatctgtttttgtggccgtaaagcaagcatggtgctgcgtcttgatcaagca
ggcagaccttataacgaaggtgagcaggtggttattggtggtaatgaacgatacgtttct
gtatgccgtaaacactataaagaggcgttacaagtcgrctcattaacggctattcaggaa
aggcatcgccacgattaa

DBGET integrated database retrieval system