KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z2242Help
Entry
Z2242             CDS       T00044                                 

Definition
(GenBank) hypothetical protein
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6
Motif
Other DBs
NCBI-ProteinID: AAG56300
UniProt: A0A384L0T2
LinkDB All DBs
Position
2023612..2024871
Genome map
AA seq 419 aa AA seqDB search
MKFPSIFNKIKPQSIQQHPEKNQLNWMLELNKWKEERILTGEIHRPECRNEAAKRINCAF
LSKQNDIDLSGLNLSTQPPGLQNFTSINLDNNQLTHFDATNYDRLVKLSLNSNTLESINI
HQGRNVSITHISMNNNCLRNIDIDRLSSITYFSAAHNKLEFVQLESCEWLQYLNLSHNQL
TDIVTGNKEELLLLDLSHNKLASLHNALFPNLNTLLINNNLLSEIKMFYSNFCKVQTLNA
ANNQLEKINLHFLTYLSSIKSLRLDNNKITRIDTENTSDIRSLFPIIKKSESLNFLNISG
ENNCPTIQLMLFNLFSPALKLNTGLAILSPGAFEDHSDGLDVDNELFHYTINKAYTPYNI
HTYKTEEVVNQRNIKIKNMTLDEINNTYCNNDYYNEAIREEPIDFLDRSFSSSSWPFYH
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcccttcaatatttaacaaaataaaaccacaatccatacagcaacatccagaa
aaaaatcaacttaactggatgctcgaattaaataaatggaaagaagaacgtatacttaca
ggtgaaatccatcgtccggaatgtcgaaacgaagccgctaaaaggataaactgtgctttt
ttgtcgaaacagaatgacattgatttatcaggacttaatttatctactcaaccaccaggg
ctgcaaaacttcacctctatcaatcttgataataaccaactcacacattttgatgcaacc
aactacgatagactcgtaaaacttagtctgaatagtaacactcttgagtcaataaatatt
catcaaggcagaaatgtaagcattacacatatatctatgaataataattgtctcagaaat
attgatatagataggctttcatcaattacttattttagtgcggcacataataaactagag
tttgtgcaattagaatcttgcgaatggctgcaatacctgaatctcagccataatcaatta
actgatattgttacaggaaataaagaagaactcttactgctggatctatcccataataaa
ctagcaagtttacacaatgccttatttcccaacttaaatacgttacttatcaacaacaac
ttgctttctgaaattaaaatgttttatagcaacttctgcaaagttcagacattaaacgct
gctaacaatcagttggaaaaaataaaccttcatttcctgacttatctttcatctatcaaa
agtttaaggctggacaataataaaataactcgcattgatactgagaacacatccgatatt
agaagtttattccccataataaagaagagcgaaagcttaaattttttaaatatttctggc
gagaacaattgccctactatccagctcatgttatttaatttgttttccccagcacttaag
cttaatactggcctggcaattctttcgcctggtgcatttgaagatcactctgacggatta
gatgtggataacgaattgtttcactatactattaataaagcatataccccatataatata
catacttataaaacagaagaagttgtaaaccagaggaatataaaaattaaaaatatgacc
ttagatgaaataaacaatacttattgtaataacgattattacaatgaggcaataagagag
gaaccgatagactttctggacagatcgttttcctccagctcatggcctttttatcactaa

DBGET integrated database retrieval system