KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z3017Help
Entry
Z3017             CDS       T00044                                 

Gene name
amyA
Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00500  Starch and sucrose metabolism
ece01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ece00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Z3017 (amyA)
Enzymes [BR:ece01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Z3017 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: AAG56942
UniProt: Q8XBB6
LinkDB All DBs
Position
2703889..2705376
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIPTKYGDKVQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRV
NADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPNEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQMKFHEAS
RMGRNYDMTQIFTGTLVEADXFHAVTXVANHDTQXLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEYPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQESVVTDENGEATFF
CNGGSVSVWVIEEVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcccacgctgttacaatgttttcactggtattacccggaaggcggtaagctc
tggcctgaattggccgagcgcgccgacggttttaatgatattggtatcaatatggtctgg
ttgccgcccgcctataaaggcgcatcgggcgggtattcggtcggctacgactcctatgat
ttatttgatttaggtgagtttgatcagaaaggcagcatccctactaaatatggcgataaa
gtacaactgctggccgccattgacgccctgaaacgtaatgacattgcggtgctgttggac
gtggtagtcaaccacaaaatgggcgcggatgaaaaagaagctattcgcgtgcagcgcgtt
aatgctgatgaccgtacgcaaattgatgaagaaatcattgaatgcgaaggctggacgcgt
tacaccttccccgctcgtgccgggcaatactcacagtttatctgggatttcaaatgtttt
agcggtatcgaccatatcgaaaaccccaatgaagatggcatttttaaaattgttaacgac
tacaccggcgaaggctggaacgatcaggttgatgatgaactcggtaatttcgattatctg
atgggcgagaatatcgattttcgcaatcatgccgtgacggaagagattaaatactgggcg
cgctgggtgatggaacaaacgcaatgcgacggttttcgtcttgatgcggtcaaacatatt
ccagcctggttttataaagagtggatcgaacacgtacaggaagttgcgccaaagccgctg
tttattgtggcggagtactggtcgcatgaagttgataagctgcaaacgtatattgatcag
gtggaaggcaaaaccatgctgtttgatgcgccgctgcagatgaaattccatgaagcatcg
cgcatgggacgcaaytacgacatgacgcagattttcactgggacgctggtggaagccgat
cyttttcacgccgtaaccytcgttgccaaccaygacacccaacygttgcaagccctcgaa
gcaccggtcgaaccgtggtttaaaccgctggcgtatgctctaattttgttgcgggaaaat
ggcgttccttcggtgttctatccggacctctacggtgcgcattacgaagatgtcggtggt
gacgggcaaacctatccgatagatatgccaataatcgaacagcttgatgagttaattctc
gcccgtcagcgtttcgcccacggtgtacagacgttatttttcgaccatccgaactgcatt
gcctttagccgcagtggcaccgacgaatatcccggctgcgtggtggtcatgtcgaacgga
gatgatggcgaaaaaaccattcatttaggagagaattacggcaataaaacctggcgtgat
tttcttgggaaccggcaagagagtgtagtaaccgacgaaaacggcgaagcgaccttcttt
tgcaacggcggcagcgttagcgtgtgggttatcgaagaggtgctttaa

DBGET integrated database retrieval system