KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z3960Help
Entry
Z3960             CDS       T00044                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase activity
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece00250  Alanine, aspartate and glutamate metabolism
ece00280  Valine, leucine and isoleucine degradation
ece00410  beta-Alanine metabolism
ece00640  Propanoate metabolism
ece00650  Butanoate metabolism
ece01100  Metabolic pathways
ece01120  Microbial metabolism in diverse environments
Module
ece_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ece00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Z3960 (gabT)
   00650 Butanoate metabolism
    Z3960 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Z3960 (gabT)
   00280 Valine, leucine and isoleucine degradation
    Z3960 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Z3960 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ece01007]
    Z3960 (gabT)
Enzymes [BR:ece01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Z3960 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Z3960 (gabT)
Amino acid related enzymes [BR:ece01007]
 Aminotransferase (transaminase)
  Class III
   Z3960 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AAG57769
UniProt: Q8X4V9
LinkDB All DBs
Structure
PDB: 

Position
3582212..3583492
Genome map
AA seq 426 aa AA seqDB search
MSSXKELMXXRSXAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQXGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcantaaagagttaatgcancnccgcagtnaggcaattcctcgtggcgttggg
caaattcaccccattttcgctgatcgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcggcattgcggtgctcaataccgggcacctgcatccg
aaagtggttgccgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtgaaa
atcgcccgcgctgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggc
ctgatgccagggcacgtttatcgcgcgctttatccttgcccactgcacggcatcagtgaa
gatgatgctatcgccagtatccaccgaatttttaaaaatgatgctgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgacgcctgcg
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagarcggcgcggggcgtaccggcacgctgtttgcgatggagcaaatgggcgtggca
ccagatctcaccacctttgcgaaatcgatcgcaggcggcttcccactggcgggcgtcacc
gggcgcgccgaagtgatggatgccgtcgctccaggcgggctgggtggcacctatgccggt
aatccgattgcctgcgtggcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcagaaagccaacgatctggggcagaagttgaaagatggattgttggcgatcgccgaa
aaacaccctgagatcggcgacgtacgcgggctgggggcgatgatcgccatcgagctgttt
gaagacggcgatcacaacaagccggacgccaaactcaccgccgagatcgtggctcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcaaagcagtag

DBGET integrated database retrieval system