KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z4101Help
Entry
Z4101             CDS       T00044                                 

Gene name
barA
Definition
(GenBank) sensor-regulator, activates OmpR by phophorylation
  KO
K07678  two-component system, NarL family, sensor histidine kinase BarA [EC:2.7.13.3]
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece02020  Two-component system
ece02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ece00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Z4101 (barA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    Z4101 (barA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ece01001]
    Z4101 (barA)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ece02022]
    Z4101 (barA)
Enzymes [BR:ece01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Z4101 (barA)
Protein kinases [BR:ece01001]
 Histidine kinases
  NarL family
   Z4101 (barA)
Two-component system [BR:ece02022]
 NarL family
  BarA-UvrY (central carbon metabolism)
   Z4101 (barA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2222 HATPase_c Response_reg HisKA Hpt HAMP HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AAG57899
UniProt: P0AEC7
LinkDB All DBs
Structure
PDB: 

Position
3704754..3707510
Genome map
AA seq 918 aa AA seqDB search
MTNYSLRARMMILILAPTVLIGLLLSIFFVVHRYNDLQRQLEDAGASIIEPLAVSTEYGM
SLQNRESIGQLISVLHRRHSDIVRAISVYDENNRLFVTSNFHLDPSSMQLGSNVPFPRQL
TVTRDGDIMILRTPIISESYSPDESPSSDAKNSQNMLGYIALELDLKSVRLQQYKEIFIS
SVMMLFCIGIALIFGWRLMRDVTGPIRNMVNTVDRIRRGQLDSRVEGFMLGELDMLKNGI
NSMAMSLAAYHEEMQHNIDQATSDLRETLEQMEIQNVELDLAKKRAQEAARIKSEFLANM
SHELRTPLNGVIGFTRLTLKTELTPTQRDHLNTIERSANNLLAIINDVLDFSKLEAGKLI
LESIPFPLRSTLDEVVTLLAHSSHDKGLELTLNIKSDVPDNVIGDPLRLQQIITNLVGNA
IKFTENGNIDILVEKRALSNTKVQIEVQIRDTGIGIPERDQSRLFQAFRQADASISRRHG
GTGLGLVITQKLVNEMGGDISFHSQPNRGSTFWFHINLDLNPNIIIEGPSTQCLAGKRLA
YVEPNSAAAQCTLDILSETPLEVVYSPTFSALPPAHYDMMLLGIAVTFREPLTMQHERLA
KAVSMTDFLMLALPCHAQVNAEKLKQDGIGACLLKPLTXTRLLPALTEFCHHKQNTLLPV
TDESKLAMTVMAVDDNPANLKLIGALLEDMVQHVELCDSGHQAVERAKQMPFDLILMDIQ
MPDMDGIRACELIHQLPHQQQTPVIAVTAHAMAGQKEKLLGAGMSDYLAKPIEEERLHNL
LLRYKPGSGISSRVVTPEVNEIVVNPNATLDWQLALRQAAGKTDLARDMLQMLLDFLPEV
RNKVEEQLVGENPEGLVDLIHKLHGSCGYSGVPRMKNLCQLIEQQLRSGTKEEDLEPELL
ELLDEMDNVAREASKILG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgaccaactacagcctgcgcgcacgcatgatgattctgatcctggcaccgaccgtcctt
attggtttattgctgagtatctttttcgtcgtgcatcgctataacgacttgcagcgtcaa
ctggaagatgccggtgccagcattattgagccgcttgcagtttctactgaatatggcatg
agcctgcaaaatcgcgaatctatcggtcagttaataagcgtactgcatcgtcgccattcc
gatattgttcgcgcgatttcggtttatgatgaaaataaccgactctttgtcacctccaat
tttcatcttgatccctcatcaatgcagctcggcagcaacgtgccgtttcctcgccagctc
actgtcactcgtgacggcgatattatgatcctccgcacgccgattatttctgagagttac
tcccccgacgaatcgcccagtagcgatgccaaaaatagtcaaaatatgttgggatatatt
gcgcttgagctggatcttaaatcggttcgcttgcagcaatataaagagatctttatttcc
agcgtgatgatgctgttttgtatcggtattgcgcttatttttggctggcgcttaatgcgc
gatgtaaccggtccgattcgcaacatggtgaatactgtcgaccgcatccgtcgcgggcaa
ctcgacagccgagtggaaggatttatgctcggcgagctggatatgctgaaaaacggtatc
aactcgatggcaatgtcgctggctgcttatcacgaagagatgcagcacaatatcgaccag
gcgacgtccgatctgcgtgaaacgctggagcagatggaaattcagaacgttgagttggat
ctggcgaaaaagcgcgcccaggaagcggcgcgtattaaatccgagtttctggcaaatatg
tcacacgagctgcgtacaccactgaatggtgttattggttttacccgcctgacgctgaaa
acagaattaacaccaacgcagcgcgatcacctgaatacgattgaacgttcggcaaataat
ttgctggcaattattaatgatgttctcgacttctcgaaactggaagcaggtaagctgatt
ctggaaagtattccattcccactacgcagcacgctggatgaagtcgttactctgctggca
cattcttctcacgataaagggttggaactgacgctcaatattaaaagcgacgtgcctgat
aacgtgatcggcgacccactgcgattacagcaaatcatcactaacctggtggggaatgca
attaaattcaccgagaatggcaacattgatattctggtagaaaaacgtgcgctgagtaat
accaaagtgcagattgaagtgcagattcgggataccggcattggtattcctgaacgcgat
caatcgcgcttattccaggccttccgacaggctgatgccagtatttcccgccgtcatggt
ggcaccgggctggggctggtgattacacaaaaactggttaatgaaatgggcggcgatatt
tcgttccatagccagccgaatcgcggttcaactttctggttccacattaatctcgatctg
aacccgaacattattattgaagggccatccacccagtgcctcgccggtaaacgcctggcc
tatgtcgaaccaaactccgcagcagcgcaatgcacgctggatattttaagtgaaacgccg
ctggaagtggtttatagcccaacgttctccgcgctgcctcccgcgcattacgacatgatg
ttgttaggcatcgcggtgaccttccgcgagccgctaacaatgcaacatgagcgattagcg
aaagcggtatcgatgaccgatttcctgatgctggcacttccttgccatgcacaagtcaat
gctgaaaaactcaagcaagatggtatcggcgcgtgtctgctgaaaccattaacacytacg
cgcctgttgcctgccctgacggaattttgtcatcacaaacaaaacacgcttttgcctgta
accgatgaaagtaagctggcaatgacagtcatggcggttgatgacaaccccgctaacctg
aaacttatcggcgcattgctggaagatatggtgcaacatgtggaactttgcgatagcggg
catcaggcggttgaacgggcgaaacagatgccgttcgatttgatcttaatggatattcaa
atgcctgacatggatggcattcgggcctgcgagctcatccaccagctcccccatcagcaa
caaacgccggttatcgcggtaacggcgcatgcaatggccgggcaaaaagagaagctgctt
ggcgcagggatgagcgattatctggcgaaaccgattgaagaagagcgattgcataatttg
ttgttgcgctacaagcctggcagcggtatttcgtctcgcgtcgtgacgcccgaagtcaac
gaaattgtggtgaacccgaatgcgaccctcgactggcaactggcactacgccaggcagca
ggaaaaaccgatttagcgcgcgatatgctgcaaatgttactcgatttcctgcctgaagtt
cgcaacaaagttgaggaacagctggttggagaaaacccggaaggcctggttgatttgatt
cataaactgcatggcagttgcggctatagcggtgtgccgcgtatgaagaatctctgccaa
cttatcgaacaacagctacgtagcggtactaaagaagaagatttggaaccggagctgctg
gaactgttggacgagatggataatgtcgcgcgcgaagccagcaaaattctcgggtaa

DBGET integrated database retrieval system