KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_0190Help
Entry
ECH74115_0190     CDS       T00778                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00061  Fatty acid biosynthesis
ecf00780  Biotin metabolism
ecf01100  Metabolic pathways
ecf01212  Fatty acid metabolism
Module
ecf_M00083  Fatty acid biosynthesis, elongation
ecf_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECH74115_0190 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ECH74115_0190 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecf01004]
    ECH74115_0190 (fabZ)
Enzymes [BR:ecf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ECH74115_0190 (fabZ)
Lipid biosynthesis proteins [BR:ecf01004]
 Fatty acid synthase
  Component type
   ECH74115_0190 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: ACI34960
UniProt: B5Z0F9
LinkDB All DBs
Structure
PDB: 

Position
205425..205880
Genome map
AA seq 151 aa AA seqDB search
MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactaacactcatactctgcagattgaagagattttagaacttctgccgcaccgt
ttcccgttcttactggtggatcgcgtgctggattttgaagaaggtcgttttctgcgcgca
gtaaaaaatgtctctgtcaatgagccattcttccagggccatttccctggaaaaccgatt
ttcccgggtgtgctgattctggaagcaatggcacaggcaacaggtattctggcgtttaaa
agcgtaggaaaactggaaccgggtgagctgtactacttcgctggtattgacgaagcgcgc
ttcaagcgcccggtcgtgcctggcgatcaaatgatcatggaagtcactttcgaaaaaacg
cgccgcggcctgacccgttttaaaggggttgctctggtcgacggtaaagtagtttgcgaa
gcaacgatgatgtgtgctcgtagccgggaggcctga

DBGET integrated database retrieval system