KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_4734Help
Entry
ECH74115_4734     CDS       T00778                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00564  Glycerophospholipid metabolism
ecf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECH74115_4734 (glpD)
Enzymes [BR:ecf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECH74115_4734 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ACI38014
LinkDB All DBs
Structure
PDB: 

Position
4378041..4379546
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYSWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGAVSDLGEDFGHEFYETELKYLVDHEWVRRADDALWRRTKQGMWLNAD
QQSRVSQWLVEYTQQKLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgctgctgaaaatggccccgcat
atcgccttcccgatgcgttttcgcctgccacatcgtccgcatctgcgcccggcgtggatg
attcgcattggtctgtttatgtacgatcatctgggtaaacgcaccagcctgccgggatca
actggtttgcgttttggcgcaaattcagtgttaaaaccggaaattaagcgcggattcgaa
tattccgactgttgggtagacgatgcccgtctggtgctcgccaacgcccagatggtggtg
cgtaaaggcggcgaagtgcttactcgtactcgtgctacttctgctcgtcgcgaaaacggc
ctgtggattgtggaagcggaagatatcgataccggcaaaaaatatagctggcaagcgcgc
ggcctggttaacgccaccggcccgtgggtgaaacagttcttcgacgacgggatgcatctg
ccttcgccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgcgtgcat
acccaaaagcaggcctacattctgcaaaacgaagataaacgtattgtgttcgtgatcccg
tggatggacgagttttccatcatcggcaccaccgatgtggaatacaaaggcgatccgaaa
gcagtgaagattgaagagagtgaaatcaattacctgctgaaagtgtataacgcgcacttt
aaaaaacagcttagccgtgacgatatcgtctggacctactccggtgtgcgtccgctgtgt
gatgatgagtccgactcgccgcaggctattacccgtgattacacccttgatattcatgat
gaaaatggcaaagcaccgctgctgtcggtattcggcggtaagctgaccacctaccgaaaa
ctggcggaacatgcgctggaaaaactaacgccgtattatcagggtattggcccggcatgg
acgaaagagagcgtgctaccgggtggcgccatcgagggcgaccgcgacgattatgccgct
cgcttacgccgccgttatccgttcctgaccgaatcgctggcacgtcattacgcgcgtact
tatggcagcaacagcgagctgctgctcggcaatgcgggagcggtaagcgatcttggggaa
gatttcggtcatgagttctacgaaacggagctgaaatatctggtcgaccacgagtgggtc
cgccgcgccgacgatgccctgtggcgtcgcacaaaacaaggcatgtggctgaatgcggat
caacaatctcgtgtgagtcagtggctggtggaatatacgcagcagaagttgtcgctggcg
tcgtaa

DBGET integrated database retrieval system