KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5416Help
Entry
ECH74115_5416     CDS       T00778                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf00620  Pyruvate metabolism
ecf00680  Methane metabolism
ecf01100  Metabolic pathways
ecf01120  Microbial metabolism in diverse environments
ecf01200  Carbon metabolism
Module
ecf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECH74115_5416 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    ECH74115_5416 (ppc)
Enzymes [BR:ecf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ECH74115_5416 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACI36605
UniProt: B5Z058
LinkDB All DBs
Structure
PDB: 

Position
complement(5060443..5063094)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILERVETIRKLSKSSRAGNDANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPELSED
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEHNQLMRRLRQ
LIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVEF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEATPELL
ALVGEEGAAEPYRYLMKNLRSRLMATQAWLEARLKGEELPKPEGLLTQNEELWEPLYACY
QSLQACGMGIIANGDLLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWQPSAETREVLDTCQVIAEAPQGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNANDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEITVSSLSLYTGAILEANLLPPPEPKESWRRIMDEL
SVISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVDKTLWPLGKELRNLQEEDIKVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEKEGQEPDPRVEQALMVTIAGIAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaagtgctggga
gaaaccatcaaggatgcgttgggagaacacattcttgaacgcgtagaaactatccgtaag
ttgtccaaatcttcacgcgctggcaatgatgctaaccgccaggagttactcaccacctta
caaaatttgtcgaacgacgagctgctgcccgttgcgcgtgcgtttagtcagttcctgaac
ctggccaacaccgccgagcaataccacagcatttcgccgaaaggcgaagctgccagcaac
ccggaagtgatcgcccgcaccctgcgtaaactgaaaaaccagccggaactgagcgaagac
accatcaaaaaagcagtggaatcgctgtcgctggaactggtcctcacggctcacccaacc
gaaattacccgtcgtacactgatccacaaaatggtggaagtgaacgcctgcttaaaacag
ctcgataacaaagatatcgctgactacgaacacaaccagctgatgcgtcgcctgcgccag
ttgatcgcccagtcatggcataccgatgaaatccgtaagctgcgtccaagcccggtagat
gaagccaaatggggctttgccgtagtagaaaacagcctgtggcaaggcgtaccgaattac
ctgcgcgaactgaacgaacaactggaagagaacctcggctacaaactgcccgtcgaattt
gttccggtacgttttacctcgtggatgggcggtgaccgcgacggcaacccgaacgtcact
gccgatatcacccgccacgtcctgctgctcagccgctggaaagccaccgatctgttcctg
aaagatattcaggttctggtttctgaactgtcgatggttgaagcgacccctgaactgctg
gcgctggttggcgaagaaggtgccgcagaaccgtatcgctatctgatgaaaaacctgcgt
tctcgcctgatggcgacacaggcatggctggaagcgcgcctgaaaggcgaagaactgcca
aaaccagaaggcctgctgacacaaaacgaagaactgtgggaaccgctctacgcttgctac
cagtcacttcaggcgtgtggcatgggtattatcgccaacggcgatctgctcgacaccctg
cgccgcgtgaaatgtttcggcgtaccgctggtccgtattgatatccgtcaggagagcacg
cgtcataccgaagcgctgggcgagctgacccgctacctcggtatcggcgactacgaaagc
tggtcagaggccgacaaacaggcgttcctgatccgcgaactgaactccaaacgtccgctt
ctgccgcgcaactggcaaccaagcgccgaaacgcgcgaagtgctcgatacctgccaggtg
attgccgaagcaccgcaaggctccattgccgcctacgtgatctcgatggcgaaaacgccg
tccgacgtgctggctgtccacctgctgctgaaagaagcgggtatcgggtttgcgatgccg
gttgctccgctgtttgaaactctcgatgacctgaacaacgccaacgatgtcatgactcag
ttgctgaatatcgactggtatcgcggcctgattcagggcaaacagatggtgatgattggc
tattccgactcagcaaaagatgcgggcgtgatggcagcgtcctgggcgcaatatcaggca
caggatgcattaatcaaaacctgcgaaaaagcgggtattgagctgacgttgttccacggt
cgcggcggttccattggtcgcggcggcgcacctgctcatgcggcgctgctgtcacaaccg
ccaggaagcctgaaaggtggcctgcgcgtgactgaacagggcgagatgatccgctttaaa
tatggtctgccagaaatcaccgtcagcagcctgtcgctttacaccggggcgatactggaa
gccaacctgctgccaccacctgagccgaaagagagctggcgtcgcattatggatgaacta
tcagtcatctcctgcgatctctaccgtggctacgtacgtgaaaacaaagattttgtgcct
tacttccgctccgctacgccggaacaggaactgggcaaactgccgttgggttcacgtccg
gcgaaacgtcgcccaaccggcggcgtcgagtcactacgcgccattccgtggatcttcgcc
tggacgcaaaaccgtctgatgctccccgcctggctgggtgcaggtacggcgctgcaaaaa
gtggtcgaagatggcaaacagagcgagctggaggctatgtgccgcgattggccattcttc
tcgacgcgtctcggcatgctggagatggtcttcgccaaagcagacctgtggctggcggaa
tactatgaccaacgcctggtagacaaaacactgtggccgttaggtaaagagttacgcaat
ctgcaagaagaagacatcaaagtggtgctggcgattgccaacgattcccatctgatggcc
gatctgccgtggattgcagagtctattcagctacggaatatttacaccgacccgctgaac
gtattgcaagccgagttgctgcaccgctcccgccaggcagaaaaagaaggccaggaaccg
gatcctcgcgtcgagcaggcgttaatggtcactattgccgggattgcggcaggtatgcgt
aataccggctaa

DBGET integrated database retrieval system