KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_0169Help
Entry
E2348C_0169       CDS       T00796                                 

Gene name
cdaR
Definition
(GenBank) DNA-binding transcriptional activator
  KO
K02647  carbohydrate diacid regulator
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecg03000]
    E2348C_0169 (cdaR)
Transcription factors [BR:ecg03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    E2348C_0169 (cdaR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Diacid_rec HTH_30 GGDEF_2 GAF_2
Motif
Other DBs
NCBI-ProteinID: CAS07717
UniProt: B7UIK9
LinkDB All DBs
Position
193223..194380
Genome map
AA seq 385 aa AA seqDB search
MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIGELHEGALLVLSQGRV
VDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPENLRKYGELVCMTAEMMLEQSR
LMHLLAQDSRLREELVMNLIQAEENTPALTEWAQRLGIDLNQPRVVAIVEVDSGQLGVDS
AMAELQQLQNALTTPERNNLVAIVSLTEMVVLKPALNSFGRWDAEDHRKRVEQLITRMKE
YGQLRFRVSLGNYFTGPGSIARSYRTAKTTMVVGKQRMPESRCYFYQDLMLPVLLDSLRG
DWQANELARPLARLKAMDNNGLLRRTLAAWFRHNVQPLATSKALFIHRNTLEYRLNRISE
LTGLDLGNFDDRLLLYVALQLDEER
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggctggctggcatcttgataccaaaatggcgcaggatatcgtggcacgtaccatgcgc
atcatcgataccaatatcaacgtaatggatgcccgcgggcgaattatcggcagcggcgat
cgtgagcgtattggtgaattgcacgaaggagcattgctggtactttcacaaggacgagtc
gtcgatatcgatgacgcggtggcacgtcatctgcacggtgtgcggcaggggattaatcta
ccgttacggctggaaggtgaaattgtcggcgtaattggcctgacaggtgaaccagagaat
ctgcgtaaatatggcgaactggtctgcatgacggctgaaatgatgctggaacagtcgcgg
ttgatgcacctgttggcgcaggatagccgtttgcgggaagaactggtgatgaacctgatt
caggctgaggagaatactcccgcacttactgaatgggcgcaacggctggggatcgatctt
aatcaaccgcgagtggtggctattgttgaggtcgacagcggtcagcttggcgtggacagc
gcaatggcggagttacagcaactgcaaaatgcgctgactacgcccgagcgtaataatctg
gtggcgattgtctcgctaaccgaaatggtggtgttgaaaccggcgttgaactcttttggg
cgctgggacgcagaagatcatcgtaagcgagttgaacaactgattacccgcatgaaagag
tatggccagctgcgttttcgcgtttcgctgggcaactattttaccggtcctggcagtatt
gcccgatcctatcgtacggcgaaaacgacgatggtggtgggtaaacagcggatgccagaa
agtcgctgctatttttatcaggatctgatgttacctgtgttactcgacagtttgcgtggc
gactggcaggccaacgaactggcgcgaccgctggcgcggctgaaagcgatggacaataac
ggcttgctgcggcgaacgctggcggcgtggtttcgccacaatgtgcaaccgctggcaacg
tcaaaggcgttgtttattcatcgtaatactctggaatatcggcttaatcgtatatcggaa
ctgaccgggcttgatttgggcaattttgatgacaggttgctgctgtatgtggcgttacaa
ctggatgaagagcggtag

DBGET integrated database retrieval system