KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1044
Entry
E2348C_1044       CDS       T00796                                 

Definition
(GenBank) T3SS secreted effector NleD homolog
  KO
K23656  T3SS secreted effector NleD
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    E2348C_1044
SSDB
Motif
Pfam: Peptidase_M91
Other DBs
NCBI-ProteinID: CAS08592
UniProt: B7UNX6
LinkDB
Position
1087845..1088543
AA seq 232 aa
MRPTSLNLVLHQSSTSSSMSDTDIESLVKASSVQWIKNNPQLRFQGTDHNIYQQIEAALD
KIGSTETGRVLLNAIESISRLKSETVVIHLNSSRLGVMAHRDIDAENHRGTGSDFHCNLN
AVEYPCGEGISVVDFHATIVFHELLHVFHNLNGERLKVESSRPESQKYSPLLLEEARTVG
LGAFSEEVLSENKFREEIGMPRRTSYPHDSALIHDDNTVSLGFQQVRLHPLL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgcgccctacgtccctcaacttggtattacatcagtcatcaacgtcgagctcaatgtca
gatacagatatcgagtctcttgtaaaagcatcgagcgttcaatggataaaaaataatccg
caacttcgtttccaggggactgatcataatatatatcagcagattgaagcagcactcgat
aagattggctctacagagacagggcgtgtactcctgaatgctattgaatcaatatcccga
cttaaatcagaaacagtggtaatacacctcaactcttccagactaggagttatggcacat
agagatatagatgctgagaaccatcgggggactggttccgattttcactgtaatctgaat
gcagttgaatatccctgtggggaggggattagcgtggtggactttcatgcgactattgtt
tttcatgagttgctccatgttttccacaatttaaatggggagcgtttgaaagttgagagt
tcccgaccagaatcacaaaaatactctccacttttactcgaagaagccaggactgttggg
ttgggggctttttcagaggaggtgctttcagaaaataaattccgcgaagagattgggatg
ccccgtagaacctcctacccgcacgactcagctcttattcatgatgacaatacagtgagt
ctgggattccaacaggtaagactgcatccattgctttag

DBGET integrated database retrieval system