KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1620Help
Entry
E2348C_1620       CDS       T00796                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase B, PLP-dependent
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00250  Alanine, aspartate and glutamate metabolism
ecg00410  beta-Alanine metabolism
ecg00430  Taurine and hypotaurine metabolism
ecg00650  Butanoate metabolism
ecg01100  Metabolic pathways
ecg01110  Biosynthesis of secondary metabolites
ecg01120  Microbial metabolism in diverse environments
ecg02024  Quorum sensing
Module
ecg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    E2348C_1620 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    E2348C_1620 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    E2348C_1620 (gadB)
   00430 Taurine and hypotaurine metabolism
    E2348C_1620 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    E2348C_1620 (gadB)
Enzymes [BR:ecg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     E2348C_1620 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 PRTase_3
Motif
Other DBs
NCBI-ProteinID: CAS09168
UniProt: B7URM6
LinkDB All DBs
Structure
PDB: 

Position
complement(1673291..1674691)
Genome map
AA seq 466 aa AA seqDB search
MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL
ATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggataagaagcaagtaacggatttaaggtcggaactactcgattcacgttttggtgcg
aagtctatttccactatcgcagaatcaaaacgttttccgctgcacgaaatgcgtgatgat
gtcgcattccagattatcaatgatgaattatatcttgatggcaacgctcgtcagaacctg
gccactttctgccagacctgggacgacgataatgtccataagttgatggatttatccatt
aacaaaaactggatcgacaaagaagaatatccgcaatctgcagcaatcgatctgcgttgc
gtaaacatggttgccgatctgtggcatgcgcctgcaccgaaaaatggtcaggccgttggc
accaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatgaaatggcgt
tggcgcaagcgtatggaagccgcaggcaaaccaacggataaaccaaacctggtgtgcggt
ccggtacaaatctgctggcataaattcgcccgctactgggatgtggagttgcgtgagatc
cctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcctgcgacgaa
aacaccatcggcgtggtgccgactttcggcgtgacctacaccggtaactatgagttcccg
cagccgctgcacgatgcgctggataaattccaggccgacaccggtatcgacatcgacatg
cacatcgacgccgccagcggtggcttcctggcaccgttcgtcgccccggatatcgtctgg
gacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattcggtctggct
ccgctgggctgcggctgggttatctggcgtgatgaagaagcgctgccgcaggaactggtg
ttcaacgttgactacctcggcggtcagattggtactttcgccatcaacttctcccgcccg
gcgggtcaggtgattgcacagtactatgaattcctgcgcctcggtcgtgaaggctatacc
aaagtacagaacgcttcctaccaggttgctgcttatctggcggatgaaatcgccaaactg
gggccgtatgagttcatctgtacgggtcgcccggacgaaggcatcccggcggtttgcttc
aaactgaaagatggtgaagatccgggatacaccctgtatgacctctctgaacgtctgcgt
ctgcgcggctggcaggttccggccttcactctcggcggtgaagccactgacatcgtggtg
atgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttgctggaagac
tacaaagcctccctgaaatatctcagcgaccacccgaaactgcagggtattgcccagcag
aacagctttaaacacacctga

DBGET integrated database retrieval system