KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1901Help
Entry
E2348C_1901       CDS       T00796                                 

Gene name
ydjJ
Definition
(GenBank) predicted oxidoreductase, Zn-dependent and NAD(P)-binding
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 ADH_N_2 Cupin_2
Motif
Other DBs
NCBI-ProteinID: CAS09449
UniProt: B7USF4
LinkDB All DBs
Structure
PDB: 

Position
complement(1962322..1963365)
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKLGKKIIILGAGCI
GLMTLQACKCLGATEIAVVDVLEKRLTMAEQLGATVVINGAKEDTIARCQQFTEDMGADI
VFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYRDVQQAFEESVNNKRDIIKGVIKISD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcaatattgcaggtgccgggcacaatgaaaattatttcagcagaa
atacctgtgcctaaagaagatgaagttttgattaaagtggaatatgtcggtatttgtggt
tcagatgtacatggttttgaatcaggcccgtttattcctcctaaagacccaaatcaagaa
attggcctgggtcatgaatgtgccgggacggttgtggctgtgggaagccgcgtgcgcaaa
tttaaaccgggggatcgggtaaatatcgaacctggcgttccttgcggtcactgtcgttac
tgtctggaaggcaaatataacatctgcccggacgttgattttatggcgacacaacccaac
taccgcggcgcattaacgcactatctgtgtcatccggagagctttacttacaaactgcca
gacaatatggacacgatggaaggggcgctggtggagcctgccgcagtcgggatgcatgcc
gcgatgctggcagatgttaaactgggtaagaagataattattctgggagcgggttgtatt
ggtttgatgacgttgcaagcgtgcaaatgcctgggagcaacggaaattgccgtcgttgat
gtgctggaaaaacgtctgacaatggcggaacagctcggcgcgacagtggttattaacggc
gcaaaagaagacactattgcacgctgtcagcaatttaccgaagacatgggcgcagatatt
gtttttgaaacagcgggttctgcggtcaccgttaaacaggcaccttatctggtcatgcgc
ggcggtaaaattatgattgttggtactgtacccggcgattcggcaatcaatttcctcaaa
atcaatcgcgaagtcactatccagacggtattccgctatgccaatcgttatccggtcacg
attgaagctatttcttcagggcgattcgatgtgaaatcgatggtgacgcatatttacgat
tatcgggatgtacaacaggcatttgaagagtcagttaacaacaaacgcgacattattaaa
ggcgttattaaaattagcgattaa

DBGET integrated database retrieval system