KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_2236
Entry
E2348C_2236       CDS       T00796                                 

Gene name
gatD
Definition
(GenBank) galactitol-1-phosphate dehydrogenase, Zn-dependent and NAD(P)-binding
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00052  Galactose metabolism
ecg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    E2348C_2236 (gatD)
Enzymes [BR:ecg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     E2348C_2236 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 3HCDH_N 2-Hacid_dh_C Shikimate_DH UDPG_MGDP_dh_N Methyltransf_25 PrmA ELFV_dehydrog FAD_binding_2
Other DBs
NCBI-ProteinID: CAS09784
UniProt: B7UTC9
LinkDB
Structure
PDB: 
4UEJ 4A2C 4UEK 4UEO

Position
complement(2300780..2301820)
AA seq 346 aa
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRNNVFALPADMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSREMSAPQIQGVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFEIFAQAVRDIARNAMPGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgatggtatcgtgcgcgtagcagaaagcgtcattcct
gaaattaaacatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttaggccatgaa
tttagtggctatattgatgcggtgggatccggtgttgatgatttacaccccggcgatgcg
gttgcctgtgtgccgttattaccctgttttacttgtccagagtgtctgaaagggttttat
tcccagtgcgcaaaatatgattttattggctcacggcgtgatggtggatttgccgaatat
attgtcgttaagcgaaacaatgtctttgcactacctgcggatatgcctattgaggatggc
gcttttattgaaccgattaccgttggcctgcatgcgttccatttagcgcaaggatgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggcaattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggctatcgacattagctcagaaaaactggcactg
gcaaaatctttcggtgcgatgcaaacatttaacagccgtgaaatgagcgcgccgcaaata
cagggcgttttacgcgagctgcgctttaatcagcttatcctcgagacggctggcgtcccg
caaaccgtcgaactggcggtagagattgccggtcctcatgcccaactggcgctggtgggc
acgttgcatcaggatctgcatttaacatctgcaacgtttggcaaaatattgcgtaaagag
ctgacggttatcggcagttggatgaactactccagcccttggccggggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaaatcttcgcccaggcggtgcgtgacatcgctcgtaatgccatgccgggc
aaagtgttgctcattccctga

DBGET integrated database retrieval system