KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_2924Help
Entry
E2348C_2924       CDS       T00796                                 

Gene name
gabD
Definition
(GenBank) succinate-semialdehyde dehydrogenase I, NADP-dependent
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00250  Alanine, aspartate and glutamate metabolism
ecg00310  Lysine degradation
ecg00350  Tyrosine metabolism
ecg00650  Butanoate metabolism
ecg00760  Nicotinate and nicotinamide metabolism
ecg01100  Metabolic pathways
ecg01120  Microbial metabolism in diverse environments
Module
ecg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    E2348C_2924 (gabD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    E2348C_2924 (gabD)
   00310 Lysine degradation
    E2348C_2924 (gabD)
   00350 Tyrosine metabolism
    E2348C_2924 (gabD)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    E2348C_2924 (gabD)
Enzymes [BR:ecg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     E2348C_2924 (gabD)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     E2348C_2924 (gabD)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     E2348C_2924 (gabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAS10472
UniProt: B7UH80
LinkDB All DBs
Structure
PDB: 

Position
3017137..3018585
Genome map
AA seq 482 aa AA seqDB search
MKLNDSNLFRQQALINGEWLAANNGEVIDVTNPANGDKLGSVPKMGADETRAAIDAANRA
LPAWRALTAKERANILRNWFNLMMEHQDDLARLMTLEQGKPLAEAKGEISYAASFIEWFA
EEGKRIYGDTIPGHQADKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLK
PASQTPFSALALAELAIRAGVPAGVFNVVTGAAGAVGNELTSNPLVRKLSFTGSTEIGRQ
LMEQCAKDIKKVSLELGGNAPFIVFDDADLDKAVEGALASKFRNAGQTCVCANRLYVQNG
VYDRFAEKLQQAVSKLHIGNGLEKGVTIGPLIDEKAVAKVEEHIADALEKGARVVCGGKS
HERGGNFFQPTILVDVPANAKVSKEETFGPLAPLFRFKDEADVIAQANDTEFGLAAYFYA
RDLSRVFRVGEALEYGIIGINTGIISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYMCI
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaacgacagtaacttattccgccagcaggcgttgattaacggggaatggctg
gccgccaacaatggcgaggtcatcgacgtcaccaatccggcgaacggcgacaagctgggt
agcgtacccaaaatgggcgctgatgaaacccgcgccgctatcgacgccgccaaccgcgct
ctgcccgcctggcgtgcgctcaccgccaaagaacgcgccaacattctgcgcaactggttc
aatttgatgatggagcatcaggacgatttagcgcgcctgatgaccctcgaacagggcaaa
ccactggccgaagcgaaaggcgaaatcagctacgccgcctcatttattgagtggtttgct
gaagaaggcaaacgtatttatggcgacaccattcccggtcatcaggccgataaacgcctg
attgttatcaagcagccgattggcgtcaccgcggctatcacgccgtggaacttcccggcg
gcgatgattacccgtaaagccggtccggcgctggcggcaggctgcacgatggtgctgaag
cccgccagtcagacgccgttctctgcgctggcgctggcagaactggcgattcgcgcgggc
gttccggctggcgtgtttaacgtggtcaccggtgcggcgggcgcggtcggtaacgaactg
accagcaacccgctggtgcgcaagctgtcgtttaccggctcgaccgaaattggccgtcag
ttaatggaacagtgcgcgaaagacatcaaaaaagtgtcgctggagctgggcggcaacgca
ccgtttattgtctttgacgatgccgatctcgataaagccgtggaaggcgcgctggcctcg
aaattccgtaacgccgggcaaacctgcgtctgcgccaaccgcctgtatgtgcagaacggc
gtgtatgaccgctttgccgaaaaattgcagcaggcggtgagcaaactgcacatcggcaac
gggctggagaaaggcgtcaccatcgggccgctgatcgatgaaaaagcggtagcaaaagtg
gaagagcatattgccgatgcgctggagaaaggcgcgcgcgtggtttgcggcggtaaatca
catgaacgcggcggtaacttcttccagccgaccattctggtggacgttccggctaacgcc
aaagtgtcgaaagaagagacgtttggccccctcgccccgctgttccgttttaaagatgaa
gccgatgtgattgcgcaggccaatgacaccgagtttggccttgcagcctatttctacgcc
cgtgatttaagccgcgtcttccgcgtgggcgaagcactggagtacggcatcatcggcatc
aacaccggcattatttccaatgaagtggccccgttcggcggcattaaagcctcgggtctg
ggtcgtgaaggttcgaagtatggcatcgaagattacttagaaatcaaatatatgtgcatc
ggtctttaa

DBGET integrated database retrieval system