KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_2925Help
Entry
E2348C_2925       CDS       T00796                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase, PLP-dependent
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg00250  Alanine, aspartate and glutamate metabolism
ecg00280  Valine, leucine and isoleucine degradation
ecg00310  Lysine degradation
ecg00410  beta-Alanine metabolism
ecg00640  Propanoate metabolism
ecg00650  Butanoate metabolism
ecg01100  Metabolic pathways
ecg01120  Microbial metabolism in diverse environments
Module
ecg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    E2348C_2925 (gabT)
   00650 Butanoate metabolism
    E2348C_2925 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    E2348C_2925 (gabT)
   00280 Valine, leucine and isoleucine degradation
    E2348C_2925 (gabT)
   00310 Lysine degradation
    E2348C_2925 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    E2348C_2925 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecg01007]
    E2348C_2925 (gabT)
Enzymes [BR:ecg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     E2348C_2925 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     E2348C_2925 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     E2348C_2925 (gabT)
Amino acid related enzymes [BR:ecg01007]
 Aminotransferase (transaminase)
  Class III
   E2348C_2925 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAS10473
UniProt: B7UH81
LinkDB All DBs
Structure
PDB: 

Position
3018599..3019879
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAVPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANVLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDSDHSKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgtagtcaggcagttcctcgtggcgttggg
caaattcaccccattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaagtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatcttgaactgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaactctgctggttacgaccggttccgaagcggtggaaaatgcggtgaaa
atcgcccgcgccgccaccaaacgtagcgggaccatcgcctttagcggtgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaagatatc
gccgccatcgtgattgagcccgttcagggcgaaggcggtttctacgccgcgacgccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcagatgggcgtggca
ccagatctcaccacctttgcgaaatcgatcgcaggcggtttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggacgccgtcgcaccgggcggactgggtggcacctatgccggt
aacccgattgcctgcgtagcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcaaaaagccaacgttctggggcagaagctgaaagacggattgctggcgatcgccgaa
aaacacccggagatcggcgacgtacgcgggctgggggcgatgatcgccatcgagctgttt
gaagatagcgatcacagcaaaccggacgcaaaactcaccgccgagatcgtggcacgcgcc
cgcgataagggtctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system