KEGG   Ehrlichia chaffeensis Arkansas: ECH_0813Help
Entry
ECH_0813          CDS       T00328                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00970  Aminoacyl-tRNA biosynthesis
ech01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ech00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECH_0813 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ech03029]
    ECH_0813 (gatB)
Enzymes [BR:ech01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ECH_0813 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ECH_0813 (gatB)
Mitochondrial biogenesis [BR:ech03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ECH_0813 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF5530 YqeY
Motif
Other DBs
NCBI-ProteinID: ABD44987
UniProt: Q2GG24
LinkDB All DBs
Position
complement(825629..827074)
Genome map
AA seq 481 aa AA seqDB search
MTIIKGNRCDWEVVIGLEVHAQVISNSKLFSGASTKTYDALPNTQVALFDVAMPGMLPVL
NEYCVYQAIKTGIALSCKINKYSAFDRKNYFYPDLPSGYQITQFYYPIATEGKIVLEDHD
MKEIRIARIHLEQDAGKSIHEFDKTYIDFNRAGVALMEIVSEPDFRSIEEVAEYLKKLRM
ILRFIETCDGDMEKGSLRCDANVSVKPVGSSELGIRSEIKNLNSIRYVMQAIEYEANRQV
NALENGEIVTQNTLLFDVTSGQTRVIRTKEDAHDYRYFPDPDLFPLKIDDQYIDHVRSSL
PELPMQKRERYTNDFSLSKYDADILSSDKDVAIYFEKVAEKHDGKLAASWITGELFGRLN
RLGITIGESSVTAEDLIQLLDLIVNNTISGKIAKQVFDMMFESGKSPALIVSEHGLKQVS
DENALSVIVERVLKNNASKVVEYKQGKEKLFGYFVGQVMKETQGKANPDMVNSIIKQQLE
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacgattattaaaggaaataggtgtgattgggaggtagtaatagggttagaagtccat
gcacaagttatttccaattctaaattattttctggtgcttcaacaaagacttatgatgct
ttacctaatacgcaagtagcgctttttgatgtagcaatgccaggtatgttgcctgtactt
aatgagtattgtgtttatcaagcaataaaaacaggaattgctctatcatgtaagattaac
aagtattcagcttttgatagaaagaattatttttatcctgacttaccttctggttatcaa
ataacacagttctattatcctatagcaacagaaggtaaaattgtcttagaagatcatgat
atgaaggaaattcgcattgctagaattcatcttgagcaagatgcaggaaaaagtattcat
gaatttgacaaaacttatatagatttcaatagggcaggtgttgcattaatggaaatagtg
tcagagcctgatttcagatctattgaagaggttgcagaatatctgaagaagttacgtatg
atattgcgttttatagaaacatgtgatggagatatggaaaaaggttctttacgttgtgat
gcaaatgtttcagtcaaacctgttggaagtagtgagcttggaataaggtctgaaataaaa
aatcttaattccattcgttatgttatgcaagctatcgagtatgaagcaaatagacaggtt
aatgctttggaaaatggagaaatagttactcaaaatacgttgttgtttgatgttacttca
gggcaaacaagagtaattaggactaaagaagatgctcatgattatcgatattttccagat
cctgacttatttccattaaagattgatgatcaatatatagatcatgtcaggtcgtcttta
ccagaactacctatgcagaaaagagagcgttatactaatgattttagtctaagtaagtat
gatgcagatattttatcttctgataaggatgtagctatatattttgaaaaggttgcagag
aagcatgatggcaaacttgcagcatcttggataacaggtgagctttttggtagactaaat
aggcttggaattactattggtgaatcttctgtgacagctgaagacttgatacagctgctt
gatttgatagtcaataatactatttctggaaaaatagcaaagcaagtgtttgatatgatg
tttgagtcaggtaaatcacctgcattgatagtcagtgaacatgggttaaagcaggtaagc
gatgagaatgctttatctgtaattgtggaaagggttttaaaaaataatgcaagtaaagta
gtagaatataaacaaggtaaagaaaaattatttgggtattttgttgggcaggtaatgaaa
gaaacgcaaggcaaagcaaaccctgatatggtaaattctattatcaagcagcagttagaa
aattaa

DBGET integrated database retrieval system