KEGG   Ehrlichia chaffeensis Heartland: ECHHL_0859Help
Entry
ECHHL_0859        CDS       T03085                                 

Definition
(GenBank) nitronate monooxygenase family protein
  KO
K02371  enoyl-[acyl-carrier protein] reductase II [EC:1.3.1.9]
Organism
echa  Ehrlichia chaffeensis Heartland
Pathway
echa00061  Fatty acid biosynthesis
echa01100  Metabolic pathways
echa01212  Fatty acid metabolism
Module
echa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:echa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECHHL_0859
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:echa01004]
    ECHHL_0859
Enzymes [BR:echa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ECHHL_0859
Lipid biosynthesis proteins [BR:echa01004]
 Fatty acid synthase
  Component type
   ECHHL_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMO FMN_dh IMPDH DHO_dh ThiG His_biosynth
Motif
Other DBs
NCBI-ProteinID: AHX03993
LinkDB All DBs
Position
989506..990552
Genome map
AA seq 348 aa AA seqDB search
MLSELWKVGIEFLGSKFAIMGGAMSWVSDPYLVSAISNAGGFGVLACGSISPEELRKEIE
LTQQLTNNAFGVNLIIMHPILNELIEVCIEKNITHIVLAGGIPNSKIISHIKNAKIKVMC
FASSLSIAKRLVRIGVDALIVEGMEAGGHIGPVSTSVLAQEILPYFRQEESLKKVPIFIA
GGIGRGEMIAHYLIMGASGCQIGTLFVCTHESRVHKNFKEIFIKSSSRDAISSSQLSKDF
SVIPVRAIENDASMKFLELQKDVISLYHQGKISKEDGQLTIEKFWAGALRKAVIDGDITN
GSLMAGQSVGMVHEIQTTEQVIQSLILQACNYITSVQKINQHQTIACT
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgctatcagaattatggaaagtaggcatagagtttttaggaagtaaatttgccattatg
ggtggagcaatgagttgggtctcagatccttacttagtatctgcaatatcaaatgccgga
ggtttcggtgttttagcatgcggttctattagtccagaagaattaagaaaagaaatagaa
cttactcaacaattaacaaacaatgcgtttggagtaaatctaattataatgcaccctatt
cttaatgaattaatcgaggtatgcattgaaaaaaacattacacacatagtattagctggt
ggtatacctaatagtaaaattataagccatattaaaaatgcaaaaattaaagtgatgtgc
tttgcatcatctttgtcaattgcaaaaagattagtaagaataggagtagacgcattaata
gtagaggggatggaagcaggtggacacataggccctgtaagtacctctgtacttgcacaa
gaaatattaccctactttaggcaagaagaatctcttaaaaaagtacccatttttattgct
ggaggcattggaaggggtgaaatgatagcacactatctaataatgggagccagtggatgt
caaattggcacgctttttgtatgcacacatgaatcacgtgtacacaaaaactttaaggaa
atctttattaaatcctcttctagagatgcaatatcatcttcacaattgagcaaagatttt
tcagtgataccagtaagagctatagaaaatgatgctagcatgaagtttttagaactacaa
aaagacgtaatcagtttataccatcaaggaaaaatttcaaaagaagatggtcaacttact
atagaaaaattttgggctggagcattacgcaaagcggtaatagatggagatattactaat
gggtctcttatggctggacaaagtgtaggtatggtacatgaaatacaaactactgaacag
gtaatccaaagtcttatactacaagcctgcaattatataacttcagtacaaaaaattaac
caacatcaaactattgcatgtacataa

DBGET integrated database retrieval system