KEGG   Enterobacter chengduensis: FY206_07250Help
Entry
FY206_07250       CDS       T06229                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
echg  Enterobacter chengduensis
Brite
KEGG Orthology (KO) [BR:echg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FY206_07250 (ahpF)
Enzymes [BR:echg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FY206_07250 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like FAD_binding_3 Thi4 K_oxygenase DAO AlaDh_PNT_C Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: QEL35222
UniProt: A0A5C1BXW2
LinkDB All DBs
Position
1469797..1471362
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEDNALPV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVYLNGQE
FGQGRMTLTEIVGKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASRLVPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSRVTGLEYRDRVSGDVHSVQLSGVFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaacatgaaaacccagctcaaggcctaccttgagaaactgaccaaaccc
gttgagctgattgccacgctggacgacagcgccaaatcggcagagatcaaggaactgctg
gcggagatcgccgaactgtcgccgaaagtgaccttcaaagaagataacgcgctgccggtt
cgtaagccctctttcctgattaccaacccaggctccgaccagggaccgcgctttgccggc
tctccgctggggcatgaatttacctcgctggtgctggcgctgctgtggaccggtggtcac
ccgtctaaagaagcgcaggcgctgctggagcagatccgcgatatcgacggagatttcgag
tttgaaacctattactcgctctcctgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgtcggtactcaacccgcgcatcaagcacacggcgattgacggcggtaccttccag
aatgagatcaccgatcgaaacgtgatgggcgttccggcggtctatctgaacggtcaggag
tttggccagggccgcatgacgctgaccgaaattgtaggcaaagtggataccggtgccgaa
aaacgtgccgcggaagcgctgaacaaacgcgatgcctacgacgtgctgatcgtcggttcc
ggccctgcgggtgcggcggcagcggtgtactccgcgcgtaaaggcattcgtaccggcctg
atgggcgaacgcttcggtggtcaggtgctcgataccgtggacattgagaactacatctcc
gtgccgaagaccgaaggccagaagctggcgggggcgctgaaggcgcacgtcagcgactat
gacgtggacgtgatcgacagccagagcgccagcaggctggtgccggcagccgtggaaggc
ggtttacaccagattgaaaccgcgtccggcgcggtgctgaaagcgcgcagcattatcatt
gccaccggcgcgaaatggcgcaacatgaacgtcccgggtgaagatcaataccgtaccaaa
ggcgtaacctactgcccgcactgcgacggcccgctgttcaaagggaaacgcgtggcggtg
atcggcggcggtaactccggcgtggaagcggctatcgacctggcggggatcgttgaacac
gttacccttctggagttcgcgccagagatgaaggccgaccaggttctgcaggataaggtt
cgcagcctgaaaaacgtcgacatcatcctgaacgcgcagaccacggaagtgaagggcgac
ggcagcagggtgaccggcctggaataccgcgaccgcgtgagcggcgacgtgcacagcgtt
cagctttcgggggttttcgtccagattggtctgctgccgaacaccacctggctggaaggc
gcgattgagcgcaaccgcatgggcgaaatcatcatcgacgcaaaatgcgaaaccagcgtg
aagggcgtgtttgcggcaggcgactgcaccaccgtgccgtacaaacagatcatcatcgcc
acgggcgaaggggcgaaggcgtcgctgagttcgtttgactacctgattcgcaccaaaacc
gcataa

DBGET integrated database retrieval system