Enterobacter chengduensis: FY206_09935 Help Entry FY206_09935       CDS       T06229                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism echg  Enterobacter chengduensis Pathway echg01100   Metabolic pathways echg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:echg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FY206_09935 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FY206_09935 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QEL35717 UniProt:  A0A5C1BZP7 LinkDB All DBs Position 2016854..2017090 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system