KEGG   Echinicola sp. LN3S3: FKX85_08175Help
Entry
FKX85_08175       CDS       T06084                                 

Definition
(GenBank) SMC family ATPase
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
echi  Echinicola sp. LN3S3
Brite
KEGG Orthology (KO) [BR:echi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:echi03400]
    FKX85_08175
DNA repair and recombination proteins [BR:echi03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FKX85_08175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SbcCD_C AAA_23 SMC_N AAA_29 AAA_21 ABC_tran
Motif
Other DBs
NCBI-ProteinID: QDH79013
LinkDB All DBs
Position
complement(2024775..2027801)
Genome map
AA seq 1008 aa AA seqDB search
MIPVKLEIEGLYSYKEKQTIDFTQLTGAGLFGIFGSVGSGKSSILEAILLALYGTTERLA
SKGEKNSMVNLQSPGIAIHFEFQAGKNNTCTYKASYIAKRNSKNFDDVKPATHTFYKKTS
EGWLPLEAKGEALVGMKMDHFRQTVIIPQGKFREFIEQKPKDRAEMMKELFGLERFDLAG
KTKQLLSIEKEKKIKLETQLEGLAVFTKDALQESESQLHQLTAQKKKEAQLLTQKEQQLN
SILAVKEKAEQLIQLKKQLEESDHRLPSFQQKRILLQQYQKALTYVKPLLDQFQELEIDL
EKYRISVTDCERFKRRFEQEIEEKNIRYQKLYQDYSNKGEKEARIRDLLQIKELNKLSAE
KAALQQDFQQLAQQNSTQQEQKDTLALQIDQAEKAMEQLDVPEMDQVSKLEAAYLELRQL
EDRSTLLSGQLKGLSEEDKSAQSAKSQLLQEAGLQEANFTTAIQKTTEKLQQVQKEREHL
LQQQGLFEYAHQLKPGEACPLCGALEHPSPLEHDFDEQKLEKTDESIRQFGHRLEALRAA
QASYEKLHITLENTQKSHLEKQQEADQVQQRIQSLLKENDAKSGIIAIDQQLKAAKTALQ
KEKMLQQQLKSLLAEQKAFLAKSEQYLTKYQEADQQVKTLQTKIETKLGEVNFPDLLEKY
REANATKIDEDIAKVKRYLDDLEINLPRAQDALNETRQQQATNLANLKTYQDRLGEVKAK
IEKIDDSLSLALSQHSFANAAAVKDLLAKQLNPSKLEEEIKAFDKQRDILQAKTQELQAD
EAVAGFDQTLYIATQEEYQTAKSTLEGTQKRVALLQKDIEEIYTKLEEKAHLKKEYQQVE
NRENNLKELYGLFQGSGFVKYVSNIYLKELVQTANIRFMQLSKNSLTLEVDESNTFWVKD
HLNGGKKRLLKTLSGGQTFQASLCLALALAEKVKSLNRADQSFFFLDEGFGALDKNALRT
VFETLKSLRHEKRIVGIISHVEELQQEIGVYAQVELDPEKGSQVTYSF
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgattcctgtaaaactggaaattgaaggattatattcttataaagaaaaacagaccatt
gacttcacccagcttactggtgccggcctttttggtattttcgggtcagtgggcagtggt
aaatcctccattttggaagccatcttgctggcactctatggtactaccgaaaggctggcc
agcaaaggcgaaaaaaacagcatggtcaacctccagagccctggcatcgccatccacttt
gaattccaagcaggtaaaaacaacacatgtacctacaaggcgtcctatattgccaagaga
aattccaagaactttgatgatgtaaagccggccacccacacattttataaaaagaccagt
gagggctggctaccgctggaggcaaaaggggaagcgctagtaggtatgaaaatggaccat
ttccgccagacggtcattattccccaaggaaaattcagggagtttatcgagcaaaaaccc
aaagaccgtgcagaaatgatgaaagaactctttgggctggaacgctttgaccttgccgga
aaaaccaagcagctgctctcgatagaaaaggaaaagaaaatcaaactcgaaacccagctg
gaaggactggcagtatttaccaaagacgctctccaagaatccgaatcccaattacaccag
cttactgcccaaaagaagaaagaggcccaactgctcacccaaaaagaacaacagctcaac
agcatcctggcggtaaaggaaaaggcggaacaacttatccagctcaaaaaacaactggaa
gaatccgatcaccggcttccgtcattccagcaaaagcggatcctgctccagcaatatcaa
aaggcgctgacctatgtaaaacctctgctcgatcagtttcaagaactggaaattgacttg
gaaaaataccgtataagtgtgaccgactgtgagcgtttcaagaggcgcttcgagcaggaa
atcgaagaaaaaaacatccgctatcaaaagctctaccaggactacagcaataaaggtgaa
aaagaagcgcgcatccgcgacctgctgcaaatcaaggaactcaacaagctctccgcggaa
aaagccgccctacagcaagacttccagcaacttgcccagcaaaacagcacccagcaagag
caaaaagacacgttggcactccaaatagaccaagctgaaaaagcgatggagcaactggat
gttcccgagatggatcaggtcagtaaactggaagcggcttatctggaactccggcaattg
gaagatagatccactctcctttccggccagctaaaaggactttctgaagaggacaagtct
gcacaatccgccaaaagccaactccttcaagaagccggtcttcaagaggccaatttcacc
actgccatccaaaaaaccacagaaaaactacagcaggtacaaaaagaacgagaacacctc
ctgcaacaacaggggctatttgaatatgcccaccaattaaagcccggggaagcatgtcca
ctttgtggtgccttggagcatccttcgccgttggagcatgattttgatgaacaaaagctg
gaaaaaacggatgaatccatccggcaattcggccatcggctggaagctttgcgcgccgcg
caggctagctatgaaaagctgcacattacgttggaaaacacccagaaaagccaccttgaa
aaacaacaggaagccgatcaggtacagcaacgcatccagtctttgctaaaagaaaatgat
gcaaaaagcggcataatagccattgaccagcaattaaaagcggccaaaacagctcttcaa
aaggagaaaatgctccagcaacagctcaaatcattactggcagaacaaaaggcatttttg
gccaaatcagaacagtacctgacaaaataccaagaagccgaccagcaggtaaaaaccctt
cagaccaaaatcgaaaccaagcttggggaagtgaattttccagacttgttggaaaaatat
agggaggcaaatgcgaccaagatcgacgaggacattgccaaggtaaaacggtacctggat
gacttggaaataaacttaccaagggcgcaggacgcccttaacgaaacccggcaacaacaa
gccaccaacttggcgaatttaaaaacctatcaagaccgattgggagaagtaaaggccaag
atagaaaaaattgatgattccctttccctggccttatcacagcatagttttgccaatgca
gccgccgtcaaggatctactggccaaacagctgaatccttctaaactggaagaggaaatc
aaggcctttgacaagcagcgtgacatcttgcaggccaaaacacaggaattacaggcagat
gaagctgtcgccggatttgaccaaaccctgtatatagccacccaggaagaatatcaaacg
gcaaaatcaaccctggaaggcacccagaagcgtgtcgcacttctccaaaaggacattgaa
gaaatctacaccaaactggaagaaaaagcacacttaaaaaaagagtatcaacaggtagaa
aaccgcgaaaacaacttaaaagagctttacggtctcttccaagggagcgggtttgtaaaa
tacgtttccaacatttacctcaaagagctggtacaaactgccaatatccgcttcatgcag
ctttccaaaaacagcttaaccttggaagtggatgaaagcaataccttttgggtaaaagac
cacctcaacggaggcaaaaaaagactgctcaaaaccctgtccggaggccagaccttccaa
gcttcactgtgcctggcattggccttggccgaaaaagtaaaatccctgaaccgcgcagac
cagagttttttcttcctggatgaaggatttggggcactggacaaaaacgcactaagaacg
gtattcgaaaccctcaaatccctaaggcatgaaaagaggatcgttggtataatttctcac
gttgaggaattgcagcaggaaatcggcgtgtacgcacaagtcgagcttgatcccgaaaag
ggcagccaagtaacctattctttttga

DBGET integrated database retrieval system