KEGG   Ehrlichia chaffeensis Liberty: ECHLIB_0624Help
Entry
ECHLIB_0624       CDS       T03190                                 

Definition
(GenBank) hypothetical protein
  KO
K23573  dentin sialophosphoprotein
Organism
echl  Ehrlichia chaffeensis Liberty
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AHX06674
LinkDB All DBs
Position
complement(700432..703245)
Genome map
AA seq 937 aa AA seqDB search
MKVKGDVVEHGDKGDIVEHEDKDSVVEHEGTVDQSIDDTHEEEGKFTEGIVSESVAEPEE
VSEADTQVDSEESQGDSSASDQVEDERVHDEVPYDTQDSTSGDKDDIVEHEDTVDQSIDD
THEEEGKFTEGIVSESVAEPEEVSEADTQVDSEESQGDSSASDQVEDERVHDEVPYDTQD
STSGDKGDIAEHDDKGDAVEHEGTVDQSIGDTHEEEGKFTEGIVSESVTEPEGVSETDTQ
VDSEESQGDSSASDQVEDERVHDEVPYDSQDDTQDSASEDEGDIAKHDDKGDAVEHEGTV
DQSIGDTHEEEGKFTEGIVSESVAEPEEVSETDTQVDSEESQGDSSASDQVEDDKVHDEV
PYDTQDSTSGDKDDIAEHEDKDSVVEHEGTVDQSIGDTHEEEGKFTEGIVSESVTEPEEV
SETDTQVDSEESQGDSSASDQVEDDKVHDEVPYDTQDSTSGDKDDIAEHEDKDSVVEHEG
TVDQSIDDTHEEEGKFTEGIVSESVTEPEGVSETDTQVDSEESQGDSSASDQVEDERVHD
EVPYDSQDDTQDSASEDEGDVVEHGDKGDIVEHEDKDSVVEHEGTVAQSIDDTYEEEGKF
TEGIVSESVTEPEEVSEADTQVNNEESQGDSSASDQVEDERVHDEVPYDAQDSTSGDKGD
IAEHGDKDDIVEHDDKDGVVEHEDTVDQSIDDTHEEEGKFTEGIVSESVTEPEEVSEADT
QVDETLQDLEHEDLKEGADDISDSETDENSSGNSDSVSDVEGLASLASIGEESTITQNVK
TQSVQSSAILSMKDRDGVLDNKGIPSDQLDVKDTEKKKKESSKSKVENSDKKAKSTKATV
TPKSLKKTFKVILSQCTQELSNKLSEAFDKLFIDPQSGKQKRRLSKQDIALMIEQLKAMI
ESLKDRKAQVTDPDEMKAIEESIKQAESTIQNLLNQE
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaaaggtgatgtcgtagaacatggtgataaaggtgatattgtagagcatgaa
gataaagatagtgttgtagaacatgagggtactgtagatcaaagtattgacgatactcat
gaagaagaaggtaagtttactgaaggaattgtatctgaaagtgtggcagaaccagaagaa
gtaagtgaagctgatactcaggttgatagtgaagaatctcaaggtgatagtagtgcttcg
gatcaagttgaggatgaaagagtacatgatgaagtaccttatgatactcaagatagtaca
tcaggagataaagatgatattgtagagcatgaggatactgtagatcaaagtattgacgat
actcatgaagaagaaggtaagtttactgaaggaattgtatctgaaagtgtggcagaacca
gaagaagtaagtgaagctgacactcaggttgatagtgaagaatctcaaggtgatagtagt
gcttcggatcaagttgaggatgaaagagtacatgatgaagtaccttatgatactcaagat
agtacatcaggagataaaggtgatattgcagaacatgatgataaaggtgatgctgtagaa
catgagggtactgtagatcaaagtattggcgatactcatgaagaagaaggtaagtttact
gaaggaattgtatctgaaagtgtgacagaaccagaaggagtaagtgaaactgatactcag
gttgatagtgaagaatctcaaggtgatagtagtgcttcggatcaagttgaagatgaaaga
gtacatgatgaagtaccttatgatagtcaagatgatactcaagatagtgcatcagaagat
gaaggtgatattgcaaaacatgatgataaaggtgatgctgtagaacatgagggtactgta
gatcaaagtattggcgatactcatgaagaagaaggtaagtttactgaaggaattgtatct
gaaagtgtggcagaaccagaagaagtaagtgaaactgatactcaggttgatagtgaagaa
tctcaaggtgatagtagtgcttcggatcaagttgaagatgacaaggtacatgatgaagta
ccttatgatactcaagatagtacatcaggagataaagatgatattgcagagcatgaagat
aaagatagtgttgtagaacatgagggtactgtagatcaaagtattggcgatactcatgaa
gaagaaggtaagtttactgaaggaattgtatctgaaagtgtgacagaaccagaagaagta
agtgaaactgatactcaggttgatagtgaagaatctcaaggtgatagtagtgcttcggat
caagttgaagatgacaaggtacatgatgaagtaccttatgatactcaagatagtacatca
ggagataaagatgatattgcagagcatgaagataaagatagtgttgtagaacatgagggt
actgtagatcaaagtattgatgatactcatgaagaagaaggtaagtttactgaaggaatt
gtatctgaaagtgtgacagaaccagaaggagtaagtgaaactgatactcaggttgatagt
gaagaatctcaaggtgatagtagtgcttcggatcaagttgaagatgaaagagtacatgat
gaagtaccttatgatagtcaagatgatactcaagatagtgcatcagaagatgaaggtgat
gtcgtagaacatggtgataaaggtgatattgtagagcatgaagataaagatagtgttgta
gaacatgagggtactgtagctcaaagtattgacgatacttatgaagaagaaggtaagttt
actgaaggaattgtatctgaaagtgtgacagaaccagaagaagtaagtgaagctgacact
caggttaataatgaagaatctcaaggtgatagtagtgcttcggatcaagttgaggatgaa
agagtacatgatgaagtaccttatgatgctcaagatagtacatcaggagataaaggtgat
attgcagaacatggtgataaagatgatattgtagagcatgatgataaagatggtgttgtg
gaacatgaggatactgtagatcaaagtattgacgatactcatgaagaagaaggtaagttt
actgaaggaattgtatctgaaagtgtgacagaaccggaggaagtaagtgaagctgatact
caggttgatgaaacacttcaggatttagaacatgaagatcttaaagagggtgctgatgat
atatctgatagtgaaacagatgaaaatagttcaggaaatagtgatagtgtatccgatgtt
gaagggttagctagtttagcatctattggtgaagaaagtacgataactcaaaatgtaaaa
acacaatctgtacagtctagtgctatattatcgatgaaagatagggacggagttctagat
aataagggtattccaagtgatcaattggatgttaaagatacagaaaagaagaagaaagaa
tctagcaaaagcaaagttgagaattctgataaaaaagcaaagtcaactaaagcaactgtg
actccaaagtctttaaagaaaacttttaaagtaatattgagtcaatgtacgcaagaatta
tcaaataaattatctgaagcttttgataagttatttatagatcctcaaagtggtaaacaa
aaacgtagattatcaaaacaagatattgcattaatgatagagcagcttaaggcaatgata
gaatcattaaaggatagaaaagcacaggtgacagatcctgatgaaatgaaagcgatagaa
gaaagtattaaacaagcagaatctacaattcagaatttattgaatcaggaataa

DBGET integrated database retrieval system