KEGG   Ehrlichia chaffeensis Saint Vincent: ECHSTV_0783Help
Entry
ECHSTV_0783       CDS       T03348                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
echv  Ehrlichia chaffeensis Saint Vincent
Pathway
echv00020  Citrate cycle (TCA cycle)
echv00190  Oxidative phosphorylation
echv00650  Butanoate metabolism
echv01100  Metabolic pathways
echv01110  Biosynthesis of secondary metabolites
echv01120  Microbial metabolism in diverse environments
echv01130  Biosynthesis of antibiotics
echv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:echv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECHSTV_0783
   00650 Butanoate metabolism
    ECHSTV_0783
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECHSTV_0783
Enzymes [BR:echv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECHSTV_0783
    1.3.5.4  fumarate reductase (quinol)
     ECHSTV_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer2
Motif
Other DBs
NCBI-ProteinID: AHX08069
LinkDB All DBs
Position
complement(897736..898512)
Genome map
AA seq 258 aa AA seqDB search
MVQFFLPKNSKVNKNGKVHHARKGAKNVKCFKIYRWSPDDDENPRIDTFFIDLDECGQMV
LDALIKIKNEVDSTLTFRRSCREGICGSCAMNIDGTNTLACTKAISDIKSDVNIYPLPHM
HVIKDLVPDLSNFYKQYESVTPWIQAEEPNHNKERLQTIEDRSKLDGIYDCILCACCSTS
CPSYWWNSDKYLGPAALLQAYRWLIDSRDEASDSRLDVLDDAFKLYRCHTIMNCTKTCPK
GLNPAKAIAHIKQMMVRR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttcaattttttttacctaagaattctaaagttaataagaacggtaaggttcatcat
gctcgtaaaggggcaaaaaatgtaaaatgttttaaaatatatagatggtctccagatgat
gatgaaaatccaaggattgatacattctttatagatcttgatgaatgtggacaaatggtg
cttgatgctttaataaagatcaaaaatgaagttgattctacattaacattcagaagatca
tgtagagaaggtatatgtggttcatgtgcgatgaacattgatggtactaacactttagct
tgtacaaaagcaatatcagatattaaatcagatgtaaatatttatcctttaccacatatg
catgtgataaaagatttagtacctgatttaagtaatttttataaacaatatgaatcagtt
actccgtggatacaagctgaagaacctaatcataataaagaaaggttacaaacaatagaa
gatagaagcaagttagatggaatatatgactgtatattgtgtgcatgttgtagtactagt
tgtcctagttattggtggaattcagataaatatttagggccagcagctttattgcaagct
tatagatggcttattgatagtagggatgaagcatcagatagtaggttagatgtacttgat
gatgcatttaaattgtatcgttgtcatactattatgaactgtactaaaacttgtcctaaa
gggttaaatccggcaaaagcaattgcacatataaaacaaatgatggtaagaagataa

DBGET integrated database retrieval system