KEGG   Ehrlichia chaffeensis Saint Vincent: ECHSTV_0784Help
Entry
ECHSTV_0784       CDS       T03348                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
echv  Ehrlichia chaffeensis Saint Vincent
Pathway
echv00020  Citrate cycle (TCA cycle)
echv00190  Oxidative phosphorylation
echv00650  Butanoate metabolism
echv01100  Metabolic pathways
echv01110  Biosynthesis of secondary metabolites
echv01120  Microbial metabolism in diverse environments
echv01130  Biosynthesis of antibiotics
echv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:echv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECHSTV_0784 (sdhA)
   00650 Butanoate metabolism
    ECHSTV_0784 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECHSTV_0784 (sdhA)
Enzymes [BR:echv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECHSTV_0784 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     ECHSTV_0784 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AHX08948
LinkDB All DBs
Position
complement(898557..900353)
Genome map
AA seq 598 aa AA seqDB search
MSGSAYDIINHEYDVVIVGAGGAGLRATFGMTNVGLSVACISKVFPTRSHTVAAQGGISA
ALGNVSEDDWRWHMFDTVKGSDWLGDQDAIEYMCKNAAEAVIELERYGVPFSRTSDGKIY
QRPFGGMTTEFGKGKPAVRTCAASDKTGHAILHTLYQQSLKYNAKFFVEYFAIDLIMDEE
GQCKGVLAWSLCDGTLHRFRAHIVVLATGGYGRIYFSATSAHTCTGDGGGMVSRINLPLE
DMEFVQFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPKAKDLASRDVVSRAMT
LEIREGRGVGPKKDHVYLSISHLGAKVISERLPGIRETARTFAGVDVIKEPIPVLPTVHY
NMGGIPTNYHGEVVTLSNNTEQIIPGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAA
IRAKELIKPGMLHAPVQKSSEEWIIDRFDALRFSKGSLRVSEIRSNMQNVMQNHAAVFRT
EEVLEEGKQKIRSVAESLSEIAVKDRSMIWNSDLVEALELTNMMPQAVVTMECAANRQES
RGAHAREDFPDRDDENWMKHSLAWYNSTDCSVHIKYKDVAKATLTDDVQYFPPQKRVY
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttctgcatatgatattataaatcatgaatatgatgttgtaatagtaggagct
ggaggagcaggtttaagagcaacttttggtatgactaatgttggtttatcagttgcatgt
atatctaaagtttttcctacacgaagtcatacagtagcagctcaaggtggtattagtgct
gcgttaggtaatgtttctgaagatgactggagatggcatatgtttgatacggtcaaaggt
tcagattggcttggagaccaagatgctattgaatatatgtgtaaaaatgcggcagaagct
gtaattgagcttgaacgttatggagttcctttttctcgtactagtgatggtaaaatatat
cagcgtccttttggtggtatgactacagagtttggtaaaggtaagccagcagtacgtacg
tgtgctgcatctgataaaacaggtcatgcaatacttcacacattgtatcagcaatcttta
aagtataatgctaagttttttgtagagtattttgctattgatttaataatggatgaagaa
ggccagtgtaagggtgtattagcatggtctttgtgtgatggtacgttacatagatttcgt
gctcatattgttgttcttgctacaggtggttatggaaggatatatttttctgctactagt
gcacacacttgtactggtgatgggggaggtatggtatcccgtattaatttgccgctggaa
gatatggaatttgtacaatttcacccgactggaatatatggtgctggatgtttgataaca
gaaggttgcagaggggaaggtggatatttaattaattctgagggagaaagatttatggag
cgctatgctccaaaagctaaagatttggcatctcgtgatgttgttagtagagcaatgact
ttagagattagagaaggtcgtggtgttggtccaaaaaaagatcatgtatatttgtctata
tctcatttaggtgcaaaagttatcagtgaaagattgccaggtattcgtgagactgcacgt
acttttgctggagtagatgttataaaggagccaataccagttttaccaactgttcattac
aatatggggggtatccctacaaattatcatggtgaagttgtaactttaagcaataataca
gagcagataatacctgggctttttgctataggagaagcagcgtgtgtatctgtacatggt
gctaaccgtttagggtctaattcattgcttgatttagtagtttttggaagagctgcagca
attagagcaaaagagttaatcaaacccggaatgttacatgctccagtgcagaagtcatca
gaagagtggataattgataggtttgatgcgttaaggttttcaaaaggaagtttacgtgta
tcagaaatacgtagtaacatgcaaaatgtaatgcaaaatcatgcagctgttttccgtaca
gaagaagtgcttgaagaaggcaagcaaaagataagaagtgttgctgagtctctgtctgaa
attgcggttaaagatagaagtatgatatggaatagtgatttggttgaagcattagagtta
actaatatgatgccgcaagcagtcgtaacaatggaatgtgctgcaaatcgtcaagaaagt
agaggggctcatgcacgtgaagatttccctgatcgtgatgatgagaattggatgaaacat
agcttagcatggtataattctacagattgttctgtacatataaagtataaagatgttgct
aaagcaactttaacagatgatgttcagtattttcctccacaaaaaagagtatattaa

DBGET integrated database retrieval system