KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C0752Help
Entry
UTI89_C0752       CDS       T00338                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00010  Glycolysis / Gluconeogenesis
eci00260  Glycine, serine and threonine metabolism
eci00680  Methane metabolism
eci01100  Metabolic pathways
eci01110  Biosynthesis of secondary metabolites
eci01120  Microbial metabolism in diverse environments
eci01130  Biosynthesis of antibiotics
eci01200  Carbon metabolism
eci01230  Biosynthesis of amino acids
Module
eci_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eci_M00002  Glycolysis, core module involving three-carbon compounds
eci_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UTI89_C0752 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    UTI89_C0752 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UTI89_C0752 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eci04131]
    UTI89_C0752 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eci04147]
    UTI89_C0752 (gpmA)
Enzymes [BR:eci01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     UTI89_C0752 (gpmA)
Membrane trafficking [BR:eci04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    UTI89_C0752 (gpmA)
Exosome [BR:eci04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   UTI89_C0752 (gpmA)
  Exosomal proteins of melanoma cells
   UTI89_C0752 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ABE06238
UniProt: Q1REH6
LinkDB All DBs
Structure
PDB: 

Position
complement(750030..750797)
Genome map
AA seq 255 aa AA seqDB search
MRSKYMAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFA
YTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQW
RRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKS
GERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADE
IAAKAAAVANQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgaggagtaagtatatggctgtaactaagctggttctggttcgtcatggcgaaagtcag
tggaacaaagaaaaccgtttcaccggttggtacgacgtggatctgtctgagaaaggcgta
agcgaagcaaaagcagcaggtaagctgctgaaagaggaaggttacagctttgactttgct
tacacctctgtgctgaaacgcgctattcataccctgtggaatgtgctggacgaactggat
caggcatggctgcccgttgagaaatcctggaaactgaacgaacgtcactacggtgcgttg
cagggtctgaacaaagcggaaaccgctgaaaagtatggcgacgagcaggtgaaacagtgg
cgtcgtggttttgcggtgactccgccggaactgactaaagatgatgagcgttatccgggt
cacgatccgcgttacgcgaaactgagcgagaaagaactgccgctgacggaaagcctggcg
ctgaccattgaccgcgtgatcccttactggaatgaaaccattctgccgcgtatgaagagc
ggtgagcgcgtcatcatcgccgcacacggtaactcgttacgtgcgctggtgaaatatctc
gataacatgagcgaagaagagattcttgagctgaatatcccgaccggcgtgccgctggtt
tatgagtttgacgagaacttcaaaccgctgaaacgctattatctgggtaatgctgacgag
atcgcggcgaaagcagcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system