KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C2128Help
Entry
UTI89_C2128       CDS       T00338                                 

Gene name
amyA
Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00500  Starch and sucrose metabolism
eci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UTI89_C2128 (amyA)
Enzymes [BR:eci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     UTI89_C2128 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: ABE07601
UniProt: Q1RAL3
LinkDB All DBs
Position
2030163..2031650
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGCIPTKYGDKAQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRV
NADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIEHPDEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQMKFHEAS
RMGRDYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEYPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQESVVTDENGEATFF
CNGGSVSVWVIEEVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcccacgctgttacaatgttttcactggtattacccggaaggcggtaagctc
tggcctgaactggccgagcgcgcagacggttttaatgatattggtatcaatatggtctgg
ttgccgcccgcctataaaggcgcatcgggcgggtattcggtcggctacgactcctatgat
ttatttgatttaggtgagtttgatcagaaaggctgcatccctactaaatatggtgataaa
gcacaactgctggccgccattgacgccctgaaacgtaatgacattgcggtgctgctggac
gtggtagtcaaccacaaaatgggcgcagatgaaaaagaagctattcgcgtgcagcgtgta
aatgctgatgaccgtacgcaaattgacgaagaaatcattgagtgtgaaggctggacgcgt
tacaccttccccgctcgtgccgggcaatactcgcagtttatctgggatttcaaatgtttt
agcggtatcgaccatatcgaacaccctgatgaagatggcatttttaaaattgttaacgac
tataccggagaaggctggaacgatcaggttgatgatgaactcggtaatttcgattatctg
atgggtgagaatatcgattttcgcaatcatgccgtgacggaagagattaaatactgggcg
cgctgggtgatggaacaaacgcaatgcgacggctttcgtcttgatgcggtcaaacatatt
ccggcatggttttataaagagtggatcgaacacgtacaggaagttgcgccaaagccgctg
tttattgtggctgaatactggtcgcatgaagtcgataaactgcaaacgtatattgatcag
gtggaaggcaaaaccatgctgtttgatgcgccgctgcagatgaaattccatgaagcatcg
cgcatgggtcgcgactacgacatgacgcagatcttcactgggacgctggtggaagccgat
ccttttcacgccgtaaccctcgttgccaaccacgacacccaaccgttgcaagccctcgaa
gcaccggtcgaaccgtggtttaaaccgctggcgtatgccttaattttgttgcgggaaaat
ggcgttccttcggtgttctatccggacctctacggtgcacattacgaagatgtcggtggt
gacgggcaaacctatccgatagatatgccaataatcgaacagcttgatgagttaattctc
gcccgtcagcgtttcgcccacggtgtacagacgttatttttcgaccatccgaactgcatt
gcctttagccgcagtggcaccgacgaatatcccggctgcgtggtggtcatgtcgaacgga
gatgatggcgaaaaaaccattcatctgggagagaattacggcaataaaacctggcgtgat
tttctggggaaccggcaagagagcgtagtgacagacgaaaacggcgaagcgaccttcttt
tgcaacggcggcagcgttagcgtgtgggttatcgaagaggtgatttaa

DBGET integrated database retrieval system