KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C3926Help
Entry
UTI89_C3926       CDS       T00338                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00564  Glycerophospholipid metabolism
eci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    UTI89_C3926 (glpD)
Enzymes [BR:eci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     UTI89_C3926 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ABE09355
UniProt: Q1R5K9
LinkDB All DBs
Structure
PDB: 

Position
3814813..3816333
Genome map
AA seq 506 aa AA seqDB search
MNEGSMETKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRY
LEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRT
SLPGSTGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSA
RRENGLWIVEAEDIDTGKKYTWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIV
VPRVHTQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKV
YNTHFKKQLSRDDIIWTYSGVRPLCDDESDSPQAITRDYTLDIHDEDGKAPLLSVFGGKL
TTYRKLAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLAR
HYARTYGSNSELLLGNAGAISDLGENFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGM
WLNADQQSRVSQWLMEYTQQRLSLAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgagggcagcatggaaaccaaagatctgattgtgataggtggcggcatcaatggt
gctggtatcgcggcagacgccgctggacgcggtttatccgtgctgatgctggaggcgcag
gatctcgcttgcgcgacctcttccgccagttcaaaactcattcacggtggcctgcgctac
cttgagcactatgaattccgactggtcagcgaggcgctggctgaacgtgaagtgctactg
aaaatggccccgcatatcgccttcccgatgcgttttcgcctgccgcatcgtccgcatcta
cgcccggcgtggatgattcgcattggtctgtttatgtacgatcatctgggtaagcgcacc
agcctgccgggatcaaccggtttgcgttttggcgcaaactcagtgttaaaaccggaaatt
aagcgcggattcgaatattctgactgttgggtagacgacgcccgtctggtactcgccaac
gcccagatggtggtgcgtaaaggcggtgaagtgcttactcgtactcgtgccacgtctgct
cgccgcgaaaacggcctgtggattgtggaggcggaagatatcgataccggcaaaaaatat
acatggcaggcgcgcggcctggttaatgctaccggcccgtgggtgaaacaatttttcgac
gacgggatgcatctgccttcgccttatggcattcgcctgatcaaaggcagccatattgtg
gtgccgcgtgtgcatacccagaagcaagcctacattctgcaaaacgaagataaacgtatt
gtcttcgtgatcccgtggatggacgagttttccatcatcggcaccaccgatgtggaatac
aaaggcgatccaaaagcagtgaagattgaagagagtgaaatcaattacctgttgaaagtg
tataacacgcactttaaaaagcagttaagccgggacgatatcatctggacctactccggc
gtgcgtccgctatgtgatgatgagtccgactcgccacaggccattacccgtgattacacc
cttgatatccatgatgaagacggcaaagccccgctgctgtcggtattcggcggtaagctg
accacctaccgcaaactggcggagcacgcgctggaaaaactgacgccatattatcagggc
attggtccggcgtggacgaaagagagcgtgctgccgggtggtgccattgaaggcgaccgt
gacgattacgccgcccgcctgcgccgccgttacccgttcctgaccgaatcgctggcacgt
cactacgcgcgcacttacggcagcaacagcgaactgttgctcggcaatgcaggggcgata
agcgacctcggtgaaaatttcggtcatgagttctacgaagcggagctgaaatatctggtc
gaccacgaatgggtccgccgcgccgacgatgccctgtggcgtcgcacgaaacaaggcatg
tggctaaatgcggatcaacaatctcgtgtgagtcagtggctgatggaatatacgcagcag
aggttgtcgctggcgtcgtaa

DBGET integrated database retrieval system