KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4626Help
Entry
UTI89_C4626       CDS       T00338                                 

Gene name
alr
Definition
(GenBank) alanine racemase 1
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00473  D-Alanine metabolism
eci01100  Metabolic pathways
eci01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UTI89_C4626 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    UTI89_C4626 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eci01011]
    UTI89_C4626 (alr)
Enzymes [BR:eci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     UTI89_C4626 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:eci01011]
 Precursor biosynthesis
  Racemase
   UTI89_C4626 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABE10034
UniProt: Q1R3N0
LinkDB All DBs
Structure
PDB: 

Position
4520406..4521485
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVTVW
MKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAIFNT
FCEGKPGQRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMSLTSS
LIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYVD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgttgtgattaaccgccgcgctctgcgacacaacctgcaacgtctt
cgtgaactggcgcctgccagtaaaatggttgcggtggtgaaagcgaacgcttatggtcac
ggtcttcttgagaccgcgcgaacgctccccgatgctgacgcctttggcgtagcccgtctc
gaagaagctctgcgactgcgtgcggggggaatcaccaaacctgtacttttactcgaaggc
ttttttgatgccagagatctaccgacgatttctgcgcaacattttcataccgccgtgcat
aacgaagaacagctggctgcgctggaagaggctagcctggacgagccggttaccgtctgg
atgaaactcgataccggtatgcaccgtctgggcgtaaggccggaacaggctgaggcgttt
tatcatcgtctgacccagtgcaaaaacgttcgtcagccggtgaatatcgtcagccatttt
gcgcgcgcggatgaaccaaaatgcggcgcaaccgagaagcaactcgctatctttaatacc
ttttgcgaaggcaaacctggtcaacgttccattgccgcgtcgggtggcattttactctgg
ccacagtcgcattttgactgggtgcgcccgggcatcattctttacggcgtatctccgctg
gaagatcgctccaccggtgccgattttggctgtcagccagtgatgtcgctaacctccagc
ctgattgccgtgcgtgagcataaagccggagagcctgtcggttatggtggaacctgggta
agcgaacgtgatactcgtcttggcgtagtcgcgatgggctatggcgatggttatccgcgc
gccgcgccgtccggtacgccagtgctggtgaacggtcgcgaagtgccgattgtcgggcgc
gtggcgatggatatgatctgcgtagacttaggtccacaggcgcaggataaagccggggac
ccggtcattttatggggcgaaggtttgcccgtagaacgtatcgctgaaatgacgaaagta
agtgcttacgaacttatcacgcgcctgacctcaagagtcgcgatgaaatacgtggattaa

DBGET integrated database retrieval system