KEGG   Escherichia coli K-12 W3110: JW0372Help
Entry
JW0372            CDS       T00068                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00473  D-Alanine metabolism
ecj00550  Peptidoglycan biosynthesis
ecj01100  Metabolic pathways
ecj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    JW0372 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JW0372 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    JW0372 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecj01011]
    JW0372 (ddlA)
Enzymes [BR:ecj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     JW0372 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ecj01011]
 Precursor biosynthesis
  Amino acid ligase
   JW0372 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: BAE76162
UniProt: P0A6J8
LinkDB All DBs
Position
complement(399053..400147)
Genome map
AA seq 364 aa AA seqDB search
MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVSDASNYLLN
ADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGL
PLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQGIKGREIECAVLGNDNPQ
ASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDKIRAIAVQAYQTLGCAGMAR
VDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactgcgggtaggaatcgtttttggtggtaaatcagcggaacatgaagtgtct
ctgcaatcggcaaaaaacattgtcgatgccattgataaaagtcgcttcgacgttgtgctg
ctgggcattgataaacaagggcaatggcacgtcagcgatgccagcaattatctgctaaat
gcagacgatcctgcccatattgcgttgcgcccttcggcgaccagccttgcgcaggtgcca
ggtaaacatgagcatcagcttatcgacgcgcaaaacggtcagccgttgccgacggtggat
gtcattttcccgattgtccacggtacgctgggcgaagatggttccttgcagggaatgctg
cgggtcgccaatttaccgtttgtaggttctgatgttctggcttcagcagcctgtatggac
aaagatgtcaccaaacgtctgctacgcgatgccgggctgaacattgcgccatttattacc
ctgacgcgcgccaatcgtcacaacattagttttgccgaagtggagtctaaactggggtta
ccactgtttgtaaaaccggctaatcagggctcttctgttggtgtcagcaaagtaaccagt
gaagaacagtacgcaattgccgtcgatctggcgttcgagttcgatcataaagtgatcgtt
gagcaagggatcaaaggtcgtgagatcgaatgcgcagttctgggcaacgacaatccgcaa
gccagcacctgtggagagatcgtactcaccagcgatttctatgcctacgacaccaagtac
attgacgaagatggcgcgaaagtggtagttccggcagccattgcgccagaaatcaacgat
aagatccgggcgattgccgttcaggcttatcaaacgttgggatgcgcaggcatggcgcgt
gtagacgtgtttttaaccccagagaacgaagtggtgatcaacgagatcaacaccctgcct
ggcttcactaatatcagtatgtatccgaagctgtggcaagccagcggtctgggttacacc
gatctgatcacacgtttgattgaactggcgctggagcgtcacgctgcggataacgcattg
aaaaccacaatgtaa

DBGET integrated database retrieval system