KEGG   Escherichia coli K-12 W3110: JW0599Help
Entry
JW0599            CDS       T00068                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F52a subunit, FAD/NAD(P)-binding
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JW0599 (ahpF)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     JW0599 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Glutaredoxin DAO FMO-like NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: BAA35236
UniProt: P35340
LinkDB All DBs
Structure
PDB: 

Position
638976..640541
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNSLPV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRHIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGKE
FGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEG
GLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAQTTEVKGD
GSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaactcaactcaaggcttaccttgagaaattgaccaagcct
gttgagttaattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgttg
gctgaaatcgcagaactgtcagacaaagtcacctttaaagaagataacagcttgccggtg
cgtaagccgtctttcctgatcaccaacccaggttccaaccaggggccacgttttgcaggc
tccccgctgggccacgagttcacctcgctggtactggcgttgctgtggaccggtggtcat
ccgtcgaaagaagcgcagtctctgctggagcagattcgccatattgacggtgattttgaa
ttcgaaacctattactcgctctcttgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgagcgtactgaacccgcgcatcaagcacactgcaattgacggcggcaccttccag
aacgaaatcaccgatcgcaacgtgatgggcgttccggcagtgttcgtaaacgggaaagag
tttggtcagggccgcatgacgttgactgaaatcgttgccaaaattgatactggcgcggaa
aaacgtgcggcagaagagctgaacaagcgtgatgcttatgacgtattaatcgtcggttcc
ggcccggcgggtgcagcggcagcaatttactccgcacgtaaaggcatccgtaccggtctg
atgggcgaacgttttggtggtcagatcctcgataccgttgatatcgaaaactacatttct
gtaccgaagactgaagggcagaagctggcaggcgcactgaaagttcacgttgatgaatac
gacgttgatgtgatcgacagccagagcgccagcaaactgatcccagcagcagttgaaggt
ggtctgcatcagattgaaacagcttctggcgcggtactgaaagcacgcagcattatcgtg
gcgaccggtgcaaaatggcgcaacatgaacgttccgggcgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggtaaacgcgtagcggtt
atcggcggcggtaactccggcgtggaagcggcaattgacctggcgggtatcgttgagcac
gtaacgctgctggaatttgcgccagaaatgaaagccgaccaggttctgcaggacaaactg
cgcagcctgaaaaacgtcgacattattctgaatgcgcaaaccacggaagtgaaaggcgac
ggcagcaaagtcgttggtctggaatatcgagatcgtgtcagcggcgatattcacaacatc
gaactggccggtattttcgtccagattggtctgctgccgaacaccaactggctcgaaggc
gcagtcgaacgtaaccgcatgggcgagattatcattgatgcgaaatgcgaaaccaacgtg
aaaggcgtgttcgcagcgggtgactgtacgacggttccgtacaagcagatcatcatcgcc
actggcgaaggtgccaaagcctctctgagtgcttttgactacctgattcgcaccaaaact
gcataa

DBGET integrated database retrieval system