KEGG   Escherichia coli K-12 W3110: JW0738Help
Entry
JW0738            CDS       T00068                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00010  Glycolysis / Gluconeogenesis
ecj00260  Glycine, serine and threonine metabolism
ecj00680  Methane metabolism
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01120  Microbial metabolism in diverse environments
ecj01130  Biosynthesis of antibiotics
ecj01200  Carbon metabolism
ecj01230  Biosynthesis of amino acids
Module
ecj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecj_M00002  Glycolysis, core module involving three-carbon compounds
ecj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JW0738 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    JW0738 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JW0738 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecj04131]
    JW0738 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecj04147]
    JW0738 (gpmA)
Enzymes [BR:ecj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     JW0738 (gpmA)
Membrane trafficking [BR:ecj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    JW0738 (gpmA)
Exosome [BR:ecj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   JW0738 (gpmA)
  Exosomal proteins of melanoma cells
   JW0738 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: BAA35417
UniProt: P62707
LinkDB All DBs
Structure
PDB: 

Position
complement(787265..788017)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctgccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagcgaa
gaagagattcttgagcttaatatcccgactggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system