KEGG   Escherichia coli K-12 W3110: JW2564Help
Entry
JW2564            CDS       T00068                                 

Gene name
ung
Definition
(GenBank) uracil-DNA-glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    JW2564 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecj03400]
    JW2564 (ung)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     JW2564 (ung)
DNA repair and recombination proteins [BR:ecj03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     JW2564 (ung)
 Prokaryotic type
     JW2564 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: BAA16466
UniProt: P12295
LinkDB All DBs
Structure
PDB: 

Position
2715410..2716099
Genome map
AA seq 229 aa AA seqDB search
MANELTWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVI
LGQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVL
LLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRH
HVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDWMPVLPAESE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgaattaacctggcatgacgtgctggctgaagagaagcagcaaccctatttt
cttaatacccttcagaccgtcgccagcgagcggcagtccggcgtcactatctacccacca
caaaaagatgtctttaacgcgttccgctttacagagttgggtgacgttaaagtggtgatt
ctcggccaggatccttatcacggaccgggacaggcgcatggtctggcattttccgttcgt
cccggcattgccattcctccgtcattattgaatatgtataaagagctggaaaatactatt
ccgggcttcacccgccctaatcatggttatcttgaaagctgggcgcgtcagggcgttctg
ctactcaatactgtgttgacggtacgcgcaggtcaggcgcattcccacgccagcctcggc
tgggaaaccttcaccgataaagtgatcagcctgattaaccagcatcgcgaaggcgtggtg
tttttgttgtggggatcgcatgcgcaaaagaaaggggcgattatagataagcaacgccat
catgtactgaaagcaccgcatccgtcgccgctttcggcgcatcgtggattctttggctgc
aaccattttgtgctggcaaatcagtggctggaacaacgtggcgagacgccgattgactgg
atgccagtattaccggcagagagtgagtaa

DBGET integrated database retrieval system